Full Text |
QUERY: Sequence Similarity = MLDPSIDSLMNKLDSKYTLVTVSARRAREMQIKKDQMIEHTISHKYVGKALEEIDAGLLSFEKEDRE AND Sequence Type = Protein AND E-Value Cutoff = 0.1 AND Identity Cutoff = 60% | MyPDB Login | Search API |
Search Summary | This query matches 1 Polymer Entity. |
Structure Determination Methodology
Scientific Name of Source Organism
Taxonomy
Experimental Method
Polymer Entity Type
Refinement Resolution (Å)
Release Date
Enzyme Classification Name
Symmetry Type
| 1 to 1 of 1 Polymer Entity Page 1 of 1 Sort by
Cryo-EM structure of Spx-dependent transcription activation complex(2021) Nucleic Acids Res 49: 10756-10769
1 to 1 of 1 Polymer Entity Page 1 of 1 Sort by |