BLASTP 2.2.18 [Mar-02-2008]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics:
Schäffer, Alejandro A., L. Aravind, Thomas L. Madden, 
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= 4HHB:A
         (141 letters)

Database: pdb_polypeptide 
           142,855 sequences; 34,350,227 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1O1N:1:A|pdbid|entity|chain(s)|sequence                               251   2e-67
1C7D:1:A|pdbid|entity|chain(s)|sequence                               251   2e-67
1Z8U:2:B,D|pdbid|entity|chain(s)|sequence                             250   3e-67
1Y01:2:B|pdbid|entity|chain(s)|sequence                               250   3e-67
1O1P:1:A|pdbid|entity|chain(s)|sequence                               250   3e-67
1C7C:1:A|pdbid|entity|chain(s)|sequence                               250   3e-67
1BZ1:1:A,C|pdbid|entity|chain(s)|sequence                             250   3e-67
1ABY:1:A|pdbid|entity|chain(s)|sequence                               250   3e-67
1ABW:1:A|pdbid|entity|chain(s)|sequence                               250   3e-67
1O1M:1:A|pdbid|entity|chain(s)|sequence                               250   4e-67
6HBW:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
4N7P:1:A,C,E,G,I,K|pdbid|entity|chain(s)|sequence                     250   4e-67
4N7O:1:A,C,E,G,I,K|pdbid|entity|chain(s)|sequence                     250   4e-67
4N7N:1:A,C,E,G,I,K|pdbid|entity|chain(s)|sequence                     250   4e-67
4MQK:1:A,C,E,G|pdbid|entity|chain(s)|sequence                         250   4e-67
4MQJ:1:A,C,E,G|pdbid|entity|chain(s)|sequence                         250   4e-67
4MQG:1:A|pdbid|entity|chain(s)|sequence                               250   4e-67
4M4B:1:A|pdbid|entity|chain(s)|sequence                               250   4e-67
4M4A:1:A|pdbid|entity|chain(s)|sequence                               250   4e-67
4L7Y:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
4IJ2:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
4HHB:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
4FC3:1:A|pdbid|entity|chain(s)|sequence                               250   4e-67
3WCP:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
3SZK:1:A,D|pdbid|entity|chain(s)|sequence                             250   4e-67
3S66:1:A|pdbid|entity|chain(s)|sequence                               250   4e-67
3S65:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
3S48:2:C,D|pdbid|entity|chain(s)|sequence                             250   4e-67
3R5I:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
3QJE:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
3QJC:1:A|pdbid|entity|chain(s)|sequence                               250   4e-67
3P5Q:1:A|pdbid|entity|chain(s)|sequence                               250   4e-67
3OVU:3:C|pdbid|entity|chain(s)|sequence                               250   4e-67
3OO5:1:A|pdbid|entity|chain(s)|sequence                               250   4e-67
3OO4:1:A|pdbid|entity|chain(s)|sequence                               250   4e-67
3ONZ:1:A|pdbid|entity|chain(s)|sequence                               250   4e-67
3ODQ:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
3NL7:1:A|pdbid|entity|chain(s)|sequence                               250   4e-67
3KMF:1:A,E|pdbid|entity|chain(s)|sequence                             250   4e-67
3IC2:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
3IC0:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
3HXN:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
3HHB:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
3DUT:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
3D7O:1:A|pdbid|entity|chain(s)|sequence                               250   4e-67
3D17:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
3B75:1:A,C,E,G,S|pdbid|entity|chain(s)|sequence                       250   4e-67
2YRS:1:A,C,I,M|pdbid|entity|chain(s)|sequence                         250   4e-67
2W6V:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
2M6Z:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
2HHE:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
2HHD:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
2HHB:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
2HCO:1:A|pdbid|entity|chain(s)|sequence                               250   4e-67
2HBS:1:A,C,E,G|pdbid|entity|chain(s)|sequence                         250   4e-67
2HBF:1:A|pdbid|entity|chain(s)|sequence                               250   4e-67
2HBE:1:A|pdbid|entity|chain(s)|sequence                               250   4e-67
2HBD:1:A|pdbid|entity|chain(s)|sequence                               250   4e-67
2HBC:1:A|pdbid|entity|chain(s)|sequence                               250   4e-67
2H35:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
2DXM:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
2DN3:1:A|pdbid|entity|chain(s)|sequence                               250   4e-67
2DN2:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
2DN1:1:A|pdbid|entity|chain(s)|sequence                               250   4e-67
2D60:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
2D5Z:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1YZI:1:A|pdbid|entity|chain(s)|sequence                               250   4e-67
1YVT:1:A|pdbid|entity|chain(s)|sequence                               250   4e-67
1YVQ:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1YIH:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1YIE:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1YHR:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1YHE:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1YH9:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1YGF:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1YGD:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1YG5:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1YFF:1:A,C,E,G|pdbid|entity|chain(s)|sequence                         250   4e-67
1YEV:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1YEU:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1YEQ:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1YEO:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1YEN:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1YE2:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1YE1:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1YE0:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1Y85:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1Y83:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1Y7Z:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1Y7G:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1Y7D:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1Y7C:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1Y5K:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1Y5J:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1Y5F:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1Y4V:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1Y4R:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1Y4Q:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1Y4P:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1Y4G:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1Y4F:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1Y4B:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1Y46:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1Y45:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1Y35:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1Y31:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1Y2Z:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1Y22:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1Y0W:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1Y0T:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1XZ2:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1XXT:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1UIW:1:A,C,E,G|pdbid|entity|chain(s)|sequence                         250   4e-67
1THB:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1SI4:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1SHR:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1SDL:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1SDK:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1RQA:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1RQ4:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1RQ3:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1RPS:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1QXE:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1QXD:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1QSI:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1QSH:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1NQP:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1NIH:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1NEJ:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1MKO:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1M9P:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1LJW:1:A|pdbid|entity|chain(s)|sequence                               250   4e-67
1LFZ:1:A|pdbid|entity|chain(s)|sequence                               250   4e-67
1LFY:1:A|pdbid|entity|chain(s)|sequence                               250   4e-67
1LFV:1:A|pdbid|entity|chain(s)|sequence                               250   4e-67
1LFT:1:A|pdbid|entity|chain(s)|sequence                               250   4e-67
1LFQ:1:A|pdbid|entity|chain(s)|sequence                               250   4e-67
1LFL:1:A,C,P,R|pdbid|entity|chain(s)|sequence                         250   4e-67
1KD2:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1K1K:1:A|pdbid|entity|chain(s)|sequence                               250   4e-67
1K0Y:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1JY7:1:A,C,P,R,U,W|pdbid|entity|chain(s)|sequence                     250   4e-67
1J41:1:A,C,E,G|pdbid|entity|chain(s)|sequence                         250   4e-67
1J40:1:A,C,E,G|pdbid|entity|chain(s)|sequence                         250   4e-67
1J3Z:1:A,C,E,G|pdbid|entity|chain(s)|sequence                         250   4e-67
1J3Y:1:A,C,E,G|pdbid|entity|chain(s)|sequence                         250   4e-67
1IRD:1:A|pdbid|entity|chain(s)|sequence                               250   4e-67
1HHO:1:A|pdbid|entity|chain(s)|sequence                               250   4e-67
1HGC:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1HGB:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1HGA:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1HDB:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1HCO:1:A|pdbid|entity|chain(s)|sequence                               250   4e-67
1HBS:1:A,C,E,G|pdbid|entity|chain(s)|sequence                         250   4e-67
1HBB:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1HBA:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1HAC:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1HAB:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1GZX:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1GBV:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1GBU:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1G9V:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1FN3:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1FDH:1:A,B|pdbid|entity|chain(s)|sequence                             250   4e-67
1DXV:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1DXU:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1DXT:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1DKE:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1COH:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1CMY:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1CLS:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1BZ0:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1BUW:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1BIJ:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1BBB:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1B86:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1A9W:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1A3N:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1A0Z:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1A0U:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1A01:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
1A00:1:A,C|pdbid|entity|chain(s)|sequence                             250   4e-67
3IA3:2:B,D|pdbid|entity|chain(s)|sequence                             249   5e-67
1BAB:1:A,C|pdbid|entity|chain(s)|sequence                             249   6e-67
1AJ9:1:A|pdbid|entity|chain(s)|sequence                               249   6e-67
1O1L:1:A|pdbid|entity|chain(s)|sequence                               249   6e-67
3NMM:1:A,C|pdbid|entity|chain(s)|sequence                             249   6e-67
1VWT:1:A,C|pdbid|entity|chain(s)|sequence                             249   7e-67
1RVW:1:A|pdbid|entity|chain(s)|sequence                               249   7e-67
1O1J:1:A|pdbid|entity|chain(s)|sequence                               249   7e-67
4MQC:1:A|pdbid|entity|chain(s)|sequence                               249   9e-67
1O1K:1:A,C|pdbid|entity|chain(s)|sequence                             249   9e-67
1J7W:1:A,C|pdbid|entity|chain(s)|sequence                             249   9e-67
1C7B:1:A,C|pdbid|entity|chain(s)|sequence                             249   9e-67
1BZZ:1:A,C|pdbid|entity|chain(s)|sequence                             249   9e-67
1GLI:1:A,C|pdbid|entity|chain(s)|sequence                             248   1e-66
2W72:1:A|pdbid|entity|chain(s)|sequence                               248   1e-66
3QJD:1:A,C|pdbid|entity|chain(s)|sequence                             248   2e-66
3QJB:1:A|pdbid|entity|chain(s)|sequence                               248   2e-66
1O1I:1:A|pdbid|entity|chain(s)|sequence                               248   2e-66
1O1O:1:A,C|pdbid|entity|chain(s)|sequence                             248   2e-66
1YDZ:1:A,C|pdbid|entity|chain(s)|sequence                             248   2e-66
1Y0C:1:A,C|pdbid|entity|chain(s)|sequence                             248   2e-66
1XY0:1:A,C|pdbid|entity|chain(s)|sequence                             248   2e-66
2W72:3:C|pdbid|entity|chain(s)|sequence                               247   2e-66
1QI8:1:A,C|pdbid|entity|chain(s)|sequence                             247   2e-66
1J7Y:1:A,C|pdbid|entity|chain(s)|sequence                             247   2e-66
1J7S:1:A,C|pdbid|entity|chain(s)|sequence                             247   2e-66
4MQI:1:A|pdbid|entity|chain(s)|sequence                               247   3e-66
1Y0D:1:A,C|pdbid|entity|chain(s)|sequence                             247   3e-66
1XZU:1:A,C|pdbid|entity|chain(s)|sequence                             247   3e-66
1A3O:1:A,C|pdbid|entity|chain(s)|sequence                             246   5e-66
1XZ5:1:A,C|pdbid|entity|chain(s)|sequence                             246   6e-66
1R1Y:1:A,C|pdbid|entity|chain(s)|sequence                             246   7e-66
1R1X:1:A|pdbid|entity|chain(s)|sequence                               246   7e-66
1XZV:1:A,C|pdbid|entity|chain(s)|sequence                             245   1e-65
1Y09:1:A,C|pdbid|entity|chain(s)|sequence                             245   1e-65
1Y8W:1:A,C|pdbid|entity|chain(s)|sequence                             245   1e-65
1XZ7:1:A,C|pdbid|entity|chain(s)|sequence                             245   1e-65
1Y0A:1:A,C|pdbid|entity|chain(s)|sequence                             244   2e-65
1XZ4:1:A,C|pdbid|entity|chain(s)|sequence                             244   2e-65
1XYE:1:A,C|pdbid|entity|chain(s)|sequence                             244   2e-65
4MQH:1:A|pdbid|entity|chain(s)|sequence                               243   4e-65
3FH9:1:A|pdbid|entity|chain(s)|sequence                               230   4e-61
2D5X:1:A|pdbid|entity|chain(s)|sequence                               226   7e-60
1IWH:1:A|pdbid|entity|chain(s)|sequence                               226   7e-60
3LQD:1:A,C|pdbid|entity|chain(s)|sequence                             226   9e-60
2RAO:1:A,C|pdbid|entity|chain(s)|sequence                             225   2e-59
2ZLX:1:A,C|pdbid|entity|chain(s)|sequence                             224   2e-59
2ZLW:1:A,C|pdbid|entity|chain(s)|sequence                             224   2e-59
2ZLV:1:A|pdbid|entity|chain(s)|sequence                               224   2e-59
2ZLU:1:A|pdbid|entity|chain(s)|sequence                               224   2e-59
2ZLT:1:A|pdbid|entity|chain(s)|sequence                               224   2e-59
2MHB:1:A|pdbid|entity|chain(s)|sequence                               224   2e-59
2DHB:1:A|pdbid|entity|chain(s)|sequence                               224   2e-59
1Y8K:1:A,C|pdbid|entity|chain(s)|sequence                             224   2e-59
1Y8I:1:A,C|pdbid|entity|chain(s)|sequence                             224   2e-59
1Y8H:1:A,C|pdbid|entity|chain(s)|sequence                             224   2e-59
1NS9:1:A|pdbid|entity|chain(s)|sequence                               224   2e-59
1NS6:1:A|pdbid|entity|chain(s)|sequence                               224   2e-59
1G0B:1:A|pdbid|entity|chain(s)|sequence                               224   2e-59
1S0H:1:A|pdbid|entity|chain(s)|sequence                               224   3e-59
3GYS:1:A,C,E,G|pdbid|entity|chain(s)|sequence                         223   4e-59
3GQR:1:A,C,E,G|pdbid|entity|chain(s)|sequence                         223   4e-59
3GQP:1:A,C|pdbid|entity|chain(s)|sequence                             223   4e-59
3D4X:1:A,C|pdbid|entity|chain(s)|sequence                             223   4e-59
1IBE:1:A|pdbid|entity|chain(s)|sequence                               223   6e-59
3HRW:1:A,C|pdbid|entity|chain(s)|sequence                             222   1e-58
3D1A:1:A,C|pdbid|entity|chain(s)|sequence                             222   1e-58
3EU1:1:A,C|pdbid|entity|chain(s)|sequence                             221   2e-58
2RI4:1:A,C,I,K|pdbid|entity|chain(s)|sequence                         221   2e-58
2QU0:1:A,C|pdbid|entity|chain(s)|sequence                             221   2e-58
3CY5:1:A,C|pdbid|entity|chain(s)|sequence                             221   2e-58
3VRG:1:A|pdbid|entity|chain(s)|sequence                               220   4e-58
3VRF:1:A|pdbid|entity|chain(s)|sequence                               220   4e-58
3VRE:1:A,C|pdbid|entity|chain(s)|sequence                             220   4e-58
3PEL:1:A|pdbid|entity|chain(s)|sequence                               220   4e-58
3GOU:1:A,C|pdbid|entity|chain(s)|sequence                             220   4e-58
2QLS:1:A,C|pdbid|entity|chain(s)|sequence                             220   4e-58
3PIA:1:A,C|pdbid|entity|chain(s)|sequence                             220   5e-58
3PI9:1:A,C|pdbid|entity|chain(s)|sequence                             220   5e-58
3PI8:1:A,C|pdbid|entity|chain(s)|sequence                             220   5e-58
3CIU:1:A,C|pdbid|entity|chain(s)|sequence                             220   5e-58
2QSS:1:A,C|pdbid|entity|chain(s)|sequence                             220   5e-58
2QSP:1:A,C|pdbid|entity|chain(s)|sequence                             220   5e-58
1HDA:1:A,C|pdbid|entity|chain(s)|sequence                             220   5e-58
1G0A:1:A,C|pdbid|entity|chain(s)|sequence                             220   5e-58
1G09:1:A,C|pdbid|entity|chain(s)|sequence                             220   5e-58
1G08:1:A,C|pdbid|entity|chain(s)|sequence                             220   5e-58
1FSX:1:A,C|pdbid|entity|chain(s)|sequence                             220   5e-58
2B7H:1:A,C|pdbid|entity|chain(s)|sequence                             219   8e-58
1FHJ:1:A,C|pdbid|entity|chain(s)|sequence                             219   8e-58
4H2L:1:A|pdbid|entity|chain(s)|sequence                               219   1e-57
3GDJ:1:A,C|pdbid|entity|chain(s)|sequence                             216   5e-57
4F4O:1:A,D,G,J|pdbid|entity|chain(s)|sequence                         216   8e-57
2PGH:1:A,C|pdbid|entity|chain(s)|sequence                             216   8e-57
1QPW:1:A,C|pdbid|entity|chain(s)|sequence                             216   8e-57
1HDS:1:A,C|pdbid|entity|chain(s)|sequence                             200   5e-52
3HYU:1:A|pdbid|entity|chain(s)|sequence                               198   2e-51
3A0G:1:A|pdbid|entity|chain(s)|sequence                               198   2e-51
3DHR:1:A,C,E,G|pdbid|entity|chain(s)|sequence                         194   4e-50
3MJU:1:A|pdbid|entity|chain(s)|sequence                               193   5e-50
2R80:1:A,C|pdbid|entity|chain(s)|sequence                             193   5e-50
3EOK:1:A|pdbid|entity|chain(s)|sequence                               191   2e-49
1FAW:1:A,C|pdbid|entity|chain(s)|sequence                             191   2e-49
2QMB:1:A,C|pdbid|entity|chain(s)|sequence                             190   4e-49
3K8B:1:A,C|pdbid|entity|chain(s)|sequence                             190   4e-49
3FS4:1:A,C|pdbid|entity|chain(s)|sequence                             189   1e-48
3A59:1:A,C,E,G|pdbid|entity|chain(s)|sequence                         189   1e-48
3MJP:1:A,C|pdbid|entity|chain(s)|sequence                             188   1e-48
3HF4:1:A,E|pdbid|entity|chain(s)|sequence                             187   4e-48
3DHT:1:A|pdbid|entity|chain(s)|sequence                               187   4e-48
1HV4:1:A,C,E,G|pdbid|entity|chain(s)|sequence                         184   3e-47
1A4F:1:A|pdbid|entity|chain(s)|sequence                               184   3e-47
2ZFB:1:A|pdbid|entity|chain(s)|sequence                               183   7e-47
1C40:1:A|pdbid|entity|chain(s)|sequence                               182   9e-47
3WTG:1:A,C|pdbid|entity|chain(s)|sequence                             181   2e-46
3AT6:1:A|pdbid|entity|chain(s)|sequence                               179   7e-46
3AT5:1:A|pdbid|entity|chain(s)|sequence                               179   7e-46
3WR1:1:A|pdbid|entity|chain(s)|sequence                               177   5e-45
1HBR:1:A,C|pdbid|entity|chain(s)|sequence                             171   3e-43
2Z6N:1:A|pdbid|entity|chain(s)|sequence                               166   9e-42
1WMU:1:A|pdbid|entity|chain(s)|sequence                               166   9e-42
1V75:1:A|pdbid|entity|chain(s)|sequence                               166   9e-42
3W4U:1:A,C,E|pdbid|entity|chain(s)|sequence                           161   2e-40
1JEB:1:A,C|pdbid|entity|chain(s)|sequence                             161   2e-40
1CH4:1:A,B,C,D|pdbid|entity|chain(s)|sequence                         156   8e-39
1OUU:1:A,C|pdbid|entity|chain(s)|sequence                             147   3e-36
1OUT:1:A|pdbid|entity|chain(s)|sequence                               147   3e-36
1V4X:1:A,C|pdbid|entity|chain(s)|sequence                             146   8e-36
1V4W:1:A,C|pdbid|entity|chain(s)|sequence                             146   8e-36
1V4U:1:A,C|pdbid|entity|chain(s)|sequence                             146   8e-36
3BJ3:1:A,C|pdbid|entity|chain(s)|sequence                             145   2e-35
3BJ2:1:A,C|pdbid|entity|chain(s)|sequence                             145   2e-35
3BJ1:1:A,C|pdbid|entity|chain(s)|sequence                             145   2e-35
1XQ5:1:A,C|pdbid|entity|chain(s)|sequence                             144   5e-35
4IRO:1:A,C|pdbid|entity|chain(s)|sequence                             140   4e-34
4G51:1:A,C|pdbid|entity|chain(s)|sequence                             140   4e-34
3GQG:1:A,C|pdbid|entity|chain(s)|sequence                             140   4e-34
3GKV:1:A|pdbid|entity|chain(s)|sequence                               140   4e-34
2PEG:1:A|pdbid|entity|chain(s)|sequence                               140   4e-34
2H8F:1:A,C|pdbid|entity|chain(s)|sequence                             140   4e-34
2H8D:1:A,C|pdbid|entity|chain(s)|sequence                             140   4e-34
1S5Y:1:A,C|pdbid|entity|chain(s)|sequence                             140   4e-34
1S5X:1:A|pdbid|entity|chain(s)|sequence                               140   4e-34
1PBX:1:A|pdbid|entity|chain(s)|sequence                               140   4e-34
1HBH:1:A,C|pdbid|entity|chain(s)|sequence                             140   4e-34
3BOM:1:A,C|pdbid|entity|chain(s)|sequence                             140   7e-34
2R1H:1:A,C|pdbid|entity|chain(s)|sequence                             140   7e-34
3NG6:1:A,C|pdbid|entity|chain(s)|sequence                             139   1e-33
3NFE:1:A,C|pdbid|entity|chain(s)|sequence                             139   1e-33
3D1K:1:A|pdbid|entity|chain(s)|sequence                               139   1e-33
2AA1:1:A,C|pdbid|entity|chain(s)|sequence                             139   1e-33
1T1N:1:A|pdbid|entity|chain(s)|sequence                               139   1e-33
1LA6:1:A|pdbid|entity|chain(s)|sequence                               139   1e-33
3BCQ:1:A,C|pdbid|entity|chain(s)|sequence                             138   3e-33
4ESA:1:A,C|pdbid|entity|chain(s)|sequence                             136   7e-33
1SPG:1:A|pdbid|entity|chain(s)|sequence                               135   1e-32
1YE2:2:B,D|pdbid|entity|chain(s)|sequence                             109   9e-25
1Y35:2:B,D|pdbid|entity|chain(s)|sequence                             109   9e-25
2HHE:2:B,D|pdbid|entity|chain(s)|sequence                             109   1e-24
1Y4V:2:B,D|pdbid|entity|chain(s)|sequence                             109   1e-24
1Y2Z:2:B,D|pdbid|entity|chain(s)|sequence                             109   1e-24
1SI4:2:B,D|pdbid|entity|chain(s)|sequence                             109   1e-24
1SHR:2:B,D|pdbid|entity|chain(s)|sequence                             109   1e-24
1Y85:2:B,D|pdbid|entity|chain(s)|sequence                             109   1e-24
1YGD:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1YEV:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1Y4P:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1RQA:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1HBA:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
3W4U:2:B,D,F|pdbid|entity|chain(s)|sequence                           108   2e-24
2HBS:2:B,D,F,H|pdbid|entity|chain(s)|sequence                         108   2e-24
1O1P:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1NEJ:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1HBS:2:B,D,F,H|pdbid|entity|chain(s)|sequence                         108   2e-24
1YIE:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1YEO:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1Y4F:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1A01:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1YEU:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1Y4G:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1DXT:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1Y0W:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1Y0T:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1O1N:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1O1L:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1J7S:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1GLI:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1DXU:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1A0Z:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1A0U:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1YGF:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1Y5J:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
4N7P:2:B,D,F,H,J,L|pdbid|entity|chain(s)|sequence                     108   2e-24
4N7O:2:B,D,F,H,J,L|pdbid|entity|chain(s)|sequence                     108   2e-24
4N7N:2:B,D,F,H,J,L|pdbid|entity|chain(s)|sequence                     108   2e-24
4MQH:2:B|pdbid|entity|chain(s)|sequence                               108   2e-24
4MQC:2:B|pdbid|entity|chain(s)|sequence                               108   2e-24
4M4B:2:B|pdbid|entity|chain(s)|sequence                               108   2e-24
4M4A:2:B|pdbid|entity|chain(s)|sequence                               108   2e-24
4L7Y:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
4IJ2:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
4HHB:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
4FC3:2:B|pdbid|entity|chain(s)|sequence                               108   2e-24
3WCP:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
3SZK:2:B,E|pdbid|entity|chain(s)|sequence                             108   2e-24
3R5I:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
3QJD:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
3QJB:2:B|pdbid|entity|chain(s)|sequence                               108   2e-24
3P5Q:2:B|pdbid|entity|chain(s)|sequence                               108   2e-24
3OO5:2:B|pdbid|entity|chain(s)|sequence                               108   2e-24
3OO4:2:B|pdbid|entity|chain(s)|sequence                               108   2e-24
3ONZ:2:B|pdbid|entity|chain(s)|sequence                               108   2e-24
3ODQ:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
3NMM:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
3KMF:2:C,G|pdbid|entity|chain(s)|sequence                             108   2e-24
3IC2:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
3IC0:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
3HXN:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
3HHB:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
3D7O:2:B|pdbid|entity|chain(s)|sequence                               108   2e-24
3D17:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
3B75:2:B,D,F,H,T|pdbid|entity|chain(s)|sequence                       108   2e-24
2W6V:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
2M6Z:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
2HHD:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
2HHB:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
2HCO:2:B|pdbid|entity|chain(s)|sequence                               108   2e-24
2HBF:2:B|pdbid|entity|chain(s)|sequence                               108   2e-24
2HBE:2:B|pdbid|entity|chain(s)|sequence                               108   2e-24
2HBD:2:B|pdbid|entity|chain(s)|sequence                               108   2e-24
2HBC:2:B|pdbid|entity|chain(s)|sequence                               108   2e-24
2H35:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
2DXM:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
2DN3:2:B|pdbid|entity|chain(s)|sequence                               108   2e-24
2DN2:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
2DN1:2:B|pdbid|entity|chain(s)|sequence                               108   2e-24
2D60:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
2D5Z:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1YZI:2:B|pdbid|entity|chain(s)|sequence                               108   2e-24
1YHR:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1YHE:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1YH9:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1YEQ:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1YDZ:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1Y8W:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1Y46:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1Y0D:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1Y0C:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1Y0A:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1Y09:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1XZV:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1XZU:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1XZ7:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1XZ5:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1XZ4:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1XZ2:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1XYE:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1XY0:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1XXT:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1VWT:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1UIW:2:B,D,F,H|pdbid|entity|chain(s)|sequence                         108   2e-24
1THB:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1SDL:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1SDK:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1RVW:2:B|pdbid|entity|chain(s)|sequence                               108   2e-24
1RQ4:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1RQ3:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1RPS:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1R1Y:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1R1X:2:B|pdbid|entity|chain(s)|sequence                               108   2e-24
1QXE:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1QXD:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1QSI:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1QSH:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1NIH:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1MKO:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1LJW:2:B|pdbid|entity|chain(s)|sequence                               108   2e-24
1LFZ:2:B|pdbid|entity|chain(s)|sequence                               108   2e-24
1LFY:2:B|pdbid|entity|chain(s)|sequence                               108   2e-24
1LFV:2:B|pdbid|entity|chain(s)|sequence                               108   2e-24
1LFT:2:B|pdbid|entity|chain(s)|sequence                               108   2e-24
1LFQ:2:B|pdbid|entity|chain(s)|sequence                               108   2e-24
1LFL:2:B,D,Q,S|pdbid|entity|chain(s)|sequence                         108   2e-24
1KD2:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1K0Y:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1JY7:2:B,D,Q,S,V,X|pdbid|entity|chain(s)|sequence                     108   2e-24
1J41:2:B,D,F,H|pdbid|entity|chain(s)|sequence                         108   2e-24
1J40:2:B,D,F,H|pdbid|entity|chain(s)|sequence                         108   2e-24
1J3Z:2:B,D,F,H|pdbid|entity|chain(s)|sequence                         108   2e-24
1J3Y:2:B,D,F,H|pdbid|entity|chain(s)|sequence                         108   2e-24
1IRD:2:B|pdbid|entity|chain(s)|sequence                               108   2e-24
1HHO:2:B|pdbid|entity|chain(s)|sequence                               108   2e-24
1HGC:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1HGB:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1HGA:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1HCO:2:B|pdbid|entity|chain(s)|sequence                               108   2e-24
1HBB:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1HAC:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1HAB:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1GZX:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1G9V:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1FN3:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1DKE:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1COH:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1CLS:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1CBM:1:A,B,C,D|pdbid|entity|chain(s)|sequence                         108   2e-24
1CBL:1:A,B,C,D|pdbid|entity|chain(s)|sequence                         108   2e-24
1BZZ:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1BZ1:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1BZ0:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1BUW:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1BIJ:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1BBB:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1BAB:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1B86:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1AJ9:2:B|pdbid|entity|chain(s)|sequence                               108   2e-24
1A3O:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1A3N:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1A00:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
3S66:2:B|pdbid|entity|chain(s)|sequence                               108   2e-24
3S65:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1YFF:2:B,D,F,H|pdbid|entity|chain(s)|sequence                         108   2e-24
1M9P:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1K1K:2:B|pdbid|entity|chain(s)|sequence                               108   2e-24
6HBW:2:B,D|pdbid|entity|chain(s)|sequence                             108   2e-24
1DXV:2:B,D|pdbid|entity|chain(s)|sequence                             108   3e-24
1C7D:2:B,D|pdbid|entity|chain(s)|sequence                             107   3e-24
1C7C:2:B,D|pdbid|entity|chain(s)|sequence                             107   3e-24
1C7B:2:B,D|pdbid|entity|chain(s)|sequence                             107   3e-24
1ABY:2:B,D|pdbid|entity|chain(s)|sequence                             107   3e-24
1ABW:2:B,D|pdbid|entity|chain(s)|sequence                             107   3e-24
1GBU:2:B,D|pdbid|entity|chain(s)|sequence                             107   3e-24
1YG5:2:B,D|pdbid|entity|chain(s)|sequence                             107   4e-24
1Y4B:2:B,D|pdbid|entity|chain(s)|sequence                             107   4e-24
1FDH:2:G,H|pdbid|entity|chain(s)|sequence                             107   4e-24
1I3E:1:A,B|pdbid|entity|chain(s)|sequence                             107   4e-24
1I3D:1:A,B|pdbid|entity|chain(s)|sequence                             107   4e-24
4MQJ:2:B,D,F,H|pdbid|entity|chain(s)|sequence                         107   5e-24
1O1O:2:B,D|pdbid|entity|chain(s)|sequence                             107   5e-24
4MQI:2:B|pdbid|entity|chain(s)|sequence                               107   5e-24
4MQG:2:B|pdbid|entity|chain(s)|sequence                               107   5e-24
2YRS:2:B,D,K,O|pdbid|entity|chain(s)|sequence                         107   5e-24
1GBV:2:B,D|pdbid|entity|chain(s)|sequence                             107   5e-24
1YE0:2:B,D|pdbid|entity|chain(s)|sequence                             107   5e-24
1Y22:2:B,D|pdbid|entity|chain(s)|sequence                             107   5e-24
1Y7Z:2:B,D|pdbid|entity|chain(s)|sequence                             107   5e-24
1O1J:2:B,D|pdbid|entity|chain(s)|sequence                             107   6e-24
1O1I:2:B|pdbid|entity|chain(s)|sequence                               107   6e-24
1HDB:2:B,D|pdbid|entity|chain(s)|sequence                             107   6e-24
3DUT:2:B,D|pdbid|entity|chain(s)|sequence                             106   7e-24
1YVT:2:B|pdbid|entity|chain(s)|sequence                               106   7e-24
1YVQ:2:B,D|pdbid|entity|chain(s)|sequence                             106   7e-24
1NQP:2:B,D|pdbid|entity|chain(s)|sequence                             106   7e-24
3HRW:2:B,D|pdbid|entity|chain(s)|sequence                             106   8e-24
1O1M:2:B,D|pdbid|entity|chain(s)|sequence                             106   8e-24
1O1K:2:B,D|pdbid|entity|chain(s)|sequence                             106   8e-24
4MQK:2:B,D,F,H|pdbid|entity|chain(s)|sequence                         106   8e-24
1YE1:2:B,D|pdbid|entity|chain(s)|sequence                             106   1e-23
1Y5F:2:B,D|pdbid|entity|chain(s)|sequence                             106   1e-23
1Y31:2:B,D|pdbid|entity|chain(s)|sequence                             106   1e-23
3NL7:2:B|pdbid|entity|chain(s)|sequence                               105   1e-23
1Y83:2:B,D|pdbid|entity|chain(s)|sequence                             105   1e-23
3FH9:2:B|pdbid|entity|chain(s)|sequence                               105   1e-23
1GCW:1:A,C|pdbid|entity|chain(s)|sequence                             105   2e-23
1GCV:1:A,C|pdbid|entity|chain(s)|sequence                             105   2e-23
3QJE:2:B,D|pdbid|entity|chain(s)|sequence                             105   2e-23
3QJC:2:B|pdbid|entity|chain(s)|sequence                               105   2e-23
1Y7D:2:B,D|pdbid|entity|chain(s)|sequence                             105   2e-23
3VRG:2:B|pdbid|entity|chain(s)|sequence                               105   2e-23
3VRF:2:B|pdbid|entity|chain(s)|sequence                               105   2e-23
3VRE:2:B,D|pdbid|entity|chain(s)|sequence                             105   2e-23
1Y7G:2:B,D|pdbid|entity|chain(s)|sequence                             105   2e-23
1YIH:2:B,D|pdbid|entity|chain(s)|sequence                             105   2e-23
1YEN:2:B,D|pdbid|entity|chain(s)|sequence                             105   2e-23
1Y7C:2:B,D|pdbid|entity|chain(s)|sequence                             105   2e-23
1Y45:2:B,D|pdbid|entity|chain(s)|sequence                             105   2e-23
1Y5K:2:B,D|pdbid|entity|chain(s)|sequence                             105   2e-23
2W72:2:B,D|pdbid|entity|chain(s)|sequence                             105   2e-23
1QI8:2:B,D|pdbid|entity|chain(s)|sequence                             105   2e-23
1J7Y:2:B,D|pdbid|entity|chain(s)|sequence                             105   2e-23
1J7W:2:B,D|pdbid|entity|chain(s)|sequence                             105   2e-23
1CMY:2:B,D|pdbid|entity|chain(s)|sequence                             105   2e-23
1Y4R:2:B,D|pdbid|entity|chain(s)|sequence                             105   3e-23
1Y4Q:2:B,D|pdbid|entity|chain(s)|sequence                             105   3e-23
3HF4:2:B,F|pdbid|entity|chain(s)|sequence                             104   3e-23
3DHT:2:B|pdbid|entity|chain(s)|sequence                               104   3e-23
2RAO:2:B,D|pdbid|entity|chain(s)|sequence                             104   4e-23
3MKB:1:A,C|pdbid|entity|chain(s)|sequence                             103   5e-23
3LQD:2:B,D|pdbid|entity|chain(s)|sequence                             103   5e-23
4H2L:2:B|pdbid|entity|chain(s)|sequence                               103   6e-23
3WTG:2:B,D|pdbid|entity|chain(s)|sequence                             103   6e-23
3MJP:2:B,D|pdbid|entity|chain(s)|sequence                             101   3e-22
3GYS:2:B,D,F,H|pdbid|entity|chain(s)|sequence                         101   3e-22
3GQR:2:B,D,F,H|pdbid|entity|chain(s)|sequence                         101   3e-22
3GQP:2:B,D|pdbid|entity|chain(s)|sequence                             101   3e-22
3D4X:2:B,D|pdbid|entity|chain(s)|sequence                             101   3e-22
3FS4:2:B,D|pdbid|entity|chain(s)|sequence                             100   4e-22
3A59:2:B,D,F,H|pdbid|entity|chain(s)|sequence                         100   4e-22
3PEL:2:B|pdbid|entity|chain(s)|sequence                               100   4e-22
3GOU:2:B,D|pdbid|entity|chain(s)|sequence                             100   4e-22
2QLS:2:B,D|pdbid|entity|chain(s)|sequence                             100   4e-22
1FHJ:2:B,D|pdbid|entity|chain(s)|sequence                             100   4e-22
3HYU:2:B|pdbid|entity|chain(s)|sequence                               100   5e-22
1HBR:2:B,D|pdbid|entity|chain(s)|sequence                             100   5e-22
1HDS:2:B,D|pdbid|entity|chain(s)|sequence                             100   6e-22
3CY5:2:B,D|pdbid|entity|chain(s)|sequence                             100   6e-22
1FAW:2:B,D|pdbid|entity|chain(s)|sequence                             100   7e-22
3K8B:2:B,D|pdbid|entity|chain(s)|sequence                             100   8e-22
2QMB:2:B,D|pdbid|entity|chain(s)|sequence                             100   8e-22
3A0G:2:B|pdbid|entity|chain(s)|sequence                               100   9e-22
4F4O:2:B,E,H,K|pdbid|entity|chain(s)|sequence                          99   1e-21
1HV4:2:B,D,F,H|pdbid|entity|chain(s)|sequence                          99   1e-21
1C40:2:B|pdbid|entity|chain(s)|sequence                                99   1e-21
1A4F:2:B|pdbid|entity|chain(s)|sequence                                99   1e-21
2ZFB:2:B|pdbid|entity|chain(s)|sequence                                99   1e-21
2PGH:2:B,D|pdbid|entity|chain(s)|sequence                              99   1e-21
1QPW:2:B,D|pdbid|entity|chain(s)|sequence                              99   1e-21
1JEB:2:B,D|pdbid|entity|chain(s)|sequence                              99   1e-21
2DHB:2:B|pdbid|entity|chain(s)|sequence                                99   2e-21
2QU0:2:B,D|pdbid|entity|chain(s)|sequence                              99   2e-21
2B7H:2:B,D|pdbid|entity|chain(s)|sequence                              99   2e-21
3EU1:2:B,D|pdbid|entity|chain(s)|sequence                              98   3e-21
3D1A:2:B,D|pdbid|entity|chain(s)|sequence                              98   3e-21
2RI4:2:B,D,J,L|pdbid|entity|chain(s)|sequence                          98   3e-21
3EOK:2:B|pdbid|entity|chain(s)|sequence                                98   4e-21
3MJU:2:B|pdbid|entity|chain(s)|sequence                                97   8e-21
3DHR:2:B,D,F,H|pdbid|entity|chain(s)|sequence                          97   8e-21
2R80:2:B,D|pdbid|entity|chain(s)|sequence                              97   8e-21
3PIA:2:B,D|pdbid|entity|chain(s)|sequence                              96   1e-20
3PI9:2:B,D|pdbid|entity|chain(s)|sequence                              96   1e-20
3PI8:2:B,D|pdbid|entity|chain(s)|sequence                              96   1e-20
3CIU:2:B,D|pdbid|entity|chain(s)|sequence                              96   1e-20
2QSS:2:B,D|pdbid|entity|chain(s)|sequence                              96   1e-20
2QSP:2:B,D|pdbid|entity|chain(s)|sequence                              96   1e-20
1HDA:2:B,D|pdbid|entity|chain(s)|sequence                              96   1e-20
1G0A:2:B,D|pdbid|entity|chain(s)|sequence                              96   1e-20
1G09:2:B,D|pdbid|entity|chain(s)|sequence                              96   1e-20
1G08:2:B,D|pdbid|entity|chain(s)|sequence                              96   1e-20
1FSX:2:B,D|pdbid|entity|chain(s)|sequence                              96   1e-20
3WR1:2:B|pdbid|entity|chain(s)|sequence                                96   1e-20
1A9W:2:E,F|pdbid|entity|chain(s)|sequence                              96   2e-20
2Z6N:2:B|pdbid|entity|chain(s)|sequence                                94   4e-20
1WMU:2:B|pdbid|entity|chain(s)|sequence                                94   4e-20
1V75:2:B|pdbid|entity|chain(s)|sequence                                94   4e-20
1SPG:2:B|pdbid|entity|chain(s)|sequence                                93   8e-20
3AT6:2:B|pdbid|entity|chain(s)|sequence                                93   1e-19
3AT5:2:B|pdbid|entity|chain(s)|sequence                                93   1e-19
1CG8:1:A|pdbid|entity|chain(s)|sequence                                92   2e-19
1CG5:1:A|pdbid|entity|chain(s)|sequence                                92   2e-19
1OUU:2:B,D|pdbid|entity|chain(s)|sequence                              90   8e-19
1OUT:2:B|pdbid|entity|chain(s)|sequence                                90   8e-19
2ZLX:2:B,D|pdbid|entity|chain(s)|sequence                              90   1e-18
2ZLW:2:B,D|pdbid|entity|chain(s)|sequence                              90   1e-18
2ZLV:2:B|pdbid|entity|chain(s)|sequence                                90   1e-18
2ZLU:2:B|pdbid|entity|chain(s)|sequence                                90   1e-18
2ZLT:2:B|pdbid|entity|chain(s)|sequence                                90   1e-18
2MHB:2:B|pdbid|entity|chain(s)|sequence                                90   1e-18
2D5X:2:B|pdbid|entity|chain(s)|sequence                                90   1e-18
1Y8K:2:B,D|pdbid|entity|chain(s)|sequence                              90   1e-18
1Y8I:2:B,D|pdbid|entity|chain(s)|sequence                              90   1e-18
1Y8H:2:B,D|pdbid|entity|chain(s)|sequence                              90   1e-18
1S0H:2:B|pdbid|entity|chain(s)|sequence                                90   1e-18
1NS9:2:B|pdbid|entity|chain(s)|sequence                                90   1e-18
1NS6:2:B|pdbid|entity|chain(s)|sequence                                90   1e-18
1IWH:2:B|pdbid|entity|chain(s)|sequence                                90   1e-18
1IBE:2:B|pdbid|entity|chain(s)|sequence                                90   1e-18
1G0B:2:B|pdbid|entity|chain(s)|sequence                                90   1e-18
3BCQ:2:B,D|pdbid|entity|chain(s)|sequence                              87   5e-18
1V4X:2:B,D|pdbid|entity|chain(s)|sequence                              86   2e-17
1V4W:2:B,D|pdbid|entity|chain(s)|sequence                              86   2e-17
1V4U:2:B,D|pdbid|entity|chain(s)|sequence                              86   2e-17
2AA1:2:B,D|pdbid|entity|chain(s)|sequence                              84   4e-17
3BOM:2:B,D|pdbid|entity|chain(s)|sequence                              84   5e-17
2R1H:2:B,D|pdbid|entity|chain(s)|sequence                              84   5e-17
3GDJ:2:B,D|pdbid|entity|chain(s)|sequence                              83   1e-16
4ESA:2:B,D|pdbid|entity|chain(s)|sequence                              83   1e-16
3NG6:2:B,D|pdbid|entity|chain(s)|sequence                              81   4e-16
3NFE:2:B,D|pdbid|entity|chain(s)|sequence                              81   4e-16
3D1K:2:B|pdbid|entity|chain(s)|sequence                                81   4e-16
1T1N:2:B|pdbid|entity|chain(s)|sequence                                81   4e-16
1LA6:2:B|pdbid|entity|chain(s)|sequence                                81   4e-16
3BJ3:2:B,D|pdbid|entity|chain(s)|sequence                              79   2e-15
3BJ2:2:B,D|pdbid|entity|chain(s)|sequence                              79   2e-15
3BJ1:2:B,D|pdbid|entity|chain(s)|sequence                              79   2e-15
1XQ5:2:B,D|pdbid|entity|chain(s)|sequence                              79   2e-15
4IRO:2:B,D|pdbid|entity|chain(s)|sequence                              79   2e-15
4G51:2:B,D|pdbid|entity|chain(s)|sequence                              79   2e-15
3GQG:2:B,D|pdbid|entity|chain(s)|sequence                              79   2e-15
3GKV:2:B|pdbid|entity|chain(s)|sequence                                79   2e-15
2PEG:2:B|pdbid|entity|chain(s)|sequence                                79   2e-15
2H8F:2:B,D|pdbid|entity|chain(s)|sequence                              79   2e-15
2H8D:2:B,D|pdbid|entity|chain(s)|sequence                              79   2e-15
1S5Y:2:B,D|pdbid|entity|chain(s)|sequence                              79   2e-15
1S5X:2:B|pdbid|entity|chain(s)|sequence                                79   2e-15
1PBX:2:B|pdbid|entity|chain(s)|sequence                                79   2e-15
1HBH:2:B,D|pdbid|entity|chain(s)|sequence                              79   2e-15
1GCW:2:B,D|pdbid|entity|chain(s)|sequence                              69   2e-12
3MKB:2:B,D|pdbid|entity|chain(s)|sequence                              68   3e-12
1GCV:2:B,D|pdbid|entity|chain(s)|sequence                              68   3e-12
1UC3:1:A,B,C,D,E,F,G,H,I,J,K,L|pdbid|entity|chain(s)|sequence          67   5e-12
1UX9:1:A,B|pdbid|entity|chain(s)|sequence                              67   9e-12
1UT0:1:A,B|pdbid|entity|chain(s)|sequence                              67   9e-12
1URY:1:A,B|pdbid|entity|chain(s)|sequence                              67   9e-12
1URV:1:A,B|pdbid|entity|chain(s)|sequence                              67   9e-12
1UMO:1:A,B|pdbid|entity|chain(s)|sequence                              67   9e-12
1F5P:1:A,B,C,D,E,F|pdbid|entity|chain(s)|sequence                      66   1e-11
1F5O:1:A,B,C,D,E,F|pdbid|entity|chain(s)|sequence                      66   1e-11
3AG0:1:A|pdbid|entity|chain(s)|sequence                                66   1e-11
3LHB:1:A,B,C,D,E,F,G,H,I,J,K,L|pdbid|entity|chain(s)|sequence          65   2e-11
2LHB:1:A|pdbid|entity|chain(s)|sequence                                65   2e-11
2DC3:1:A,B|pdbid|entity|chain(s)|sequence                              65   2e-11
1V5H:1:A|pdbid|entity|chain(s)|sequence                                65   2e-11
4B3W:1:A,B|pdbid|entity|chain(s)|sequence                              65   4e-11
1CG8:2:B|pdbid|entity|chain(s)|sequence                                61   5e-10
1CG5:2:B|pdbid|entity|chain(s)|sequence                                61   5e-10
1HLM:1:A|pdbid|entity|chain(s)|sequence                                53   1e-07
1LHT:1:A|pdbid|entity|chain(s)|sequence                                50   7e-07
1LHS:1:A|pdbid|entity|chain(s)|sequence                                50   7e-07
1MYH:1:A,B|pdbid|entity|chain(s)|sequence                              48   4e-06
1PMB:1:A,B|pdbid|entity|chain(s)|sequence                              48   4e-06
1MYG:1:A,B|pdbid|entity|chain(s)|sequence                              48   4e-06
1MWD:1:A,B|pdbid|entity|chain(s)|sequence                              48   4e-06
1MWC:1:A,B|pdbid|entity|chain(s)|sequence                              48   4e-06
1MYI:1:A,B|pdbid|entity|chain(s)|sequence                              47   5e-06
1MBS:1:A|pdbid|entity|chain(s)|sequence                                46   1e-05
1YCB:1:A,B|pdbid|entity|chain(s)|sequence                              46   1e-05
1YCA:1:A,B|pdbid|entity|chain(s)|sequence                              46   1e-05
1MYJ:1:A,B|pdbid|entity|chain(s)|sequence                              46   1e-05
1MNH:1:A|pdbid|entity|chain(s)|sequence                                45   3e-05
1MNO:1:A,B|pdbid|entity|chain(s)|sequence                              45   3e-05
1MDN:1:A,B|pdbid|entity|chain(s)|sequence                              45   3e-05
1M6M:1:A,B|pdbid|entity|chain(s)|sequence                              45   3e-05
1M6C:1:A,B|pdbid|entity|chain(s)|sequence                              45   3e-05
3RGK:1:A|pdbid|entity|chain(s)|sequence                                45   3e-05
2NX0:1:A|pdbid|entity|chain(s)|sequence                                45   3e-05
2NRM:1:A|pdbid|entity|chain(s)|sequence                                45   3e-05
2NRL:1:A|pdbid|entity|chain(s)|sequence                                45   3e-05
3QMA:1:A|pdbid|entity|chain(s)|sequence                                45   4e-05
3QM9:1:A|pdbid|entity|chain(s)|sequence                                45   4e-05
3QM8:1:A|pdbid|entity|chain(s)|sequence                                45   4e-05
3QM7:1:A|pdbid|entity|chain(s)|sequence                                45   4e-05
3QM6:1:A|pdbid|entity|chain(s)|sequence                                45   4e-05
3QM5:1:A|pdbid|entity|chain(s)|sequence                                45   4e-05
1MYT:1:A|pdbid|entity|chain(s)|sequence                                44   6e-05
1NZ5:1:A|pdbid|entity|chain(s)|sequence                                44   7e-05
1NZ4:1:A|pdbid|entity|chain(s)|sequence                                44   7e-05
1NZ3:1:A|pdbid|entity|chain(s)|sequence                                44   7e-05
1NZ2:1:A|pdbid|entity|chain(s)|sequence                                44   7e-05
3RJN:1:B|pdbid|entity|chain(s)|sequence                                44   8e-05
1MNJ:1:A,B|pdbid|entity|chain(s)|sequence                              44   8e-05
3WI8:1:A|pdbid|entity|chain(s)|sequence                                44   8e-05
3VM9:1:A,B|pdbid|entity|chain(s)|sequence                              44   8e-05
3VAU:1:A|pdbid|entity|chain(s)|sequence                                44   8e-05
3V2Z:1:A|pdbid|entity|chain(s)|sequence                                44   8e-05
3V2V:1:A|pdbid|entity|chain(s)|sequence                                44   8e-05
3LR9:1:A|pdbid|entity|chain(s)|sequence                                44   8e-05
3LR7:1:A|pdbid|entity|chain(s)|sequence                                44   8e-05
3BA2:1:A|pdbid|entity|chain(s)|sequence                                44   8e-05
2VM0:1:A|pdbid|entity|chain(s)|sequence                                44   8e-05
2VLZ:1:A|pdbid|entity|chain(s)|sequence                                44   8e-05
2VLY:1:A|pdbid|entity|chain(s)|sequence                                44   8e-05
2VLX:1:A|pdbid|entity|chain(s)|sequence                                44   8e-05
2V1K:1:A|pdbid|entity|chain(s)|sequence                                44   8e-05
2V1J:1:A|pdbid|entity|chain(s)|sequence                                44   8e-05
2V1I:1:A|pdbid|entity|chain(s)|sequence                                44   8e-05
2V1H:1:A|pdbid|entity|chain(s)|sequence                                44   8e-05
2V1G:1:A|pdbid|entity|chain(s)|sequence                                44   8e-05
2V1F:1:A|pdbid|entity|chain(s)|sequence                                44   8e-05
2V1E:1:A|pdbid|entity|chain(s)|sequence                                44   8e-05
2O5T:1:X|pdbid|entity|chain(s)|sequence                                44   8e-05
2O5S:1:X|pdbid|entity|chain(s)|sequence                                44   8e-05
2O5Q:1:X|pdbid|entity|chain(s)|sequence                                44   8e-05
2O5O:1:X|pdbid|entity|chain(s)|sequence                                44   8e-05
2O5M:1:X|pdbid|entity|chain(s)|sequence                                44   8e-05
2O5L:1:X|pdbid|entity|chain(s)|sequence                                44   8e-05
2O5B:1:X|pdbid|entity|chain(s)|sequence                                44   8e-05
2O58:1:X|pdbid|entity|chain(s)|sequence                                44   8e-05
2NSS:1:A|pdbid|entity|chain(s)|sequence                                44   8e-05
2NSR:1:A|pdbid|entity|chain(s)|sequence                                44   8e-05
2IN4:1:A|pdbid|entity|chain(s)|sequence                                44   8e-05
2FRK:1:X|pdbid|entity|chain(s)|sequence                                44   8e-05
2FRJ:1:X|pdbid|entity|chain(s)|sequence                                44   8e-05
2FRI:1:X|pdbid|entity|chain(s)|sequence                                44   8e-05
2FRF:1:A|pdbid|entity|chain(s)|sequence                                44   8e-05
1YMC:1:A|pdbid|entity|chain(s)|sequence                                44   8e-05
1YMB:1:A|pdbid|entity|chain(s)|sequence                                44   8e-05
1WLA:1:A|pdbid|entity|chain(s)|sequence                                44   8e-05
1NPG:1:A|pdbid|entity|chain(s)|sequence                                44   8e-05
1NPF:1:A|pdbid|entity|chain(s)|sequence                                44   8e-05
1GJN:1:A|pdbid|entity|chain(s)|sequence                                44   8e-05
1DWT:1:A|pdbid|entity|chain(s)|sequence                                44   8e-05
1DWS:1:A|pdbid|entity|chain(s)|sequence                                44   8e-05
1DWR:1:A|pdbid|entity|chain(s)|sequence                                44   8e-05
1AZI:1:A|pdbid|entity|chain(s)|sequence                                44   8e-05
4DC8:1:A|pdbid|entity|chain(s)|sequence                                44   9e-05
4DC7:1:A|pdbid|entity|chain(s)|sequence                                44   9e-05
1CP5:1:A|pdbid|entity|chain(s)|sequence                                43   1e-04
1RSE:1:A|pdbid|entity|chain(s)|sequence                                43   1e-04
1CH5:1:A|pdbid|entity|chain(s)|sequence                                42   2e-04
1CH7:1:A|pdbid|entity|chain(s)|sequence                                42   2e-04
3RJ6:1:A,B|pdbid|entity|chain(s)|sequence                              42   2e-04
3A2G:1:A|pdbid|entity|chain(s)|sequence                                42   2e-04
3HEO:1:A|pdbid|entity|chain(s)|sequence                                42   2e-04
3HEN:1:A|pdbid|entity|chain(s)|sequence                                42   2e-04
1XCH:1:A|pdbid|entity|chain(s)|sequence                                42   2e-04
1MNK:1:A,B|pdbid|entity|chain(s)|sequence                              42   2e-04
4HRT:1:A,C,E,G|pdbid|entity|chain(s)|sequence                          42   2e-04
4HRR:1:A,C,E,G|pdbid|entity|chain(s)|sequence                          42   2e-04
1H1X:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
1IT3:1:A,B,C,D|pdbid|entity|chain(s)|sequence                          42   3e-04
1IT2:1:A,B|pdbid|entity|chain(s)|sequence                              42   3e-04
3U3E:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
2W6W:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
2JHO:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
2EB9:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
2EB8:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
1UFP:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
1CH9:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
5MBN:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
4MBN:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
3EDB:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
3EDA:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
3ED9:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
3ECZ:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
3ECX:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
3ECL:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
3E5O:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
3E5I:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
3E55:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
3E4N:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
2ZT4:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
2ZT3:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
2ZT2:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
2ZT1:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
2ZT0:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
2ZSZ:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
2ZSY:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
2ZSX:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
2ZST:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
2ZSS:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
2ZSR:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
2ZSQ:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
2ZSP:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
2ZSO:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
2ZSN:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
2Z6T:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
2Z6S:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
2MYE:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
2MYD:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
2MYC:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
2MYB:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
2MYA:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
2MB5:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
2EKU:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
2EKT:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
2D6C:1:A,B|pdbid|entity|chain(s)|sequence                              42   3e-04
2CMM:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
1YOI:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
1YOH:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
1YOG:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
1WVP:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
1VXH:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
1VXG:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
1VXF:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
1VXE:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
1VXD:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
1VXC:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
1VXB:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
1VXA:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
1U7S:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
1U7R:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
1SWM:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
1SPE:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
1MYF:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
1MBO:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
1MBN:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
1MBI:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
1MBD:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
1MBC:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
1L2K:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
1JPB:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
1JP9:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
1JP8:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
1JP6:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
1IOP:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
1HJT:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
1F6H:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
1EBC:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
1DUK:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
1CQ2:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
1BZR:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
1BZP:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
1BZ6:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
1BVD:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
1BVC:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
1AJH:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
1AJG:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
105M:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
104M:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
1YMA:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
1HRM:1:A|pdbid|entity|chain(s)|sequence                                42   3e-04
1CIO:1:A|pdbid|entity|chain(s)|sequence                                41   3e-04
1A6N:1:A|pdbid|entity|chain(s)|sequence                                41   3e-04
1A6M:1:A|pdbid|entity|chain(s)|sequence                                41   3e-04
1A6K:1:A|pdbid|entity|chain(s)|sequence                                41   3e-04
1CPW:1:A|pdbid|entity|chain(s)|sequence                                41   4e-04
3ASE:1:A|pdbid|entity|chain(s)|sequence                                41   4e-04
2MGM:1:A|pdbid|entity|chain(s)|sequence                                41   4e-04
2MGL:1:A|pdbid|entity|chain(s)|sequence                                41   4e-04
2MGK:1:A|pdbid|entity|chain(s)|sequence                                41   4e-04
2MBW:1:A|pdbid|entity|chain(s)|sequence                                41   4e-04
1TES:1:A|pdbid|entity|chain(s)|sequence                                41   4e-04
1JW8:1:A|pdbid|entity|chain(s)|sequence                                41   4e-04
1J52:1:A|pdbid|entity|chain(s)|sequence                                41   4e-04
1ABS:1:A|pdbid|entity|chain(s)|sequence                                41   4e-04
112M:1:A|pdbid|entity|chain(s)|sequence                                41   4e-04
111M:1:A|pdbid|entity|chain(s)|sequence                                41   4e-04
110M:1:A|pdbid|entity|chain(s)|sequence                                41   4e-04
109M:1:A|pdbid|entity|chain(s)|sequence                                41   4e-04
1DTI:1:A|pdbid|entity|chain(s)|sequence                                41   5e-04
1MNI:1:A,B|pdbid|entity|chain(s)|sequence                              41   5e-04
1A6G:1:A|pdbid|entity|chain(s)|sequence                                41   6e-04
2OH8:1:A|pdbid|entity|chain(s)|sequence                                41   6e-04
1MLO:1:A|pdbid|entity|chain(s)|sequence                                41   6e-04
1MLN:1:A|pdbid|entity|chain(s)|sequence                                41   6e-04
1MLM:1:A|pdbid|entity|chain(s)|sequence                                41   6e-04
1CO9:1:A|pdbid|entity|chain(s)|sequence                                40   6e-04
3HEP:1:A|pdbid|entity|chain(s)|sequence                                40   7e-04
3HC9:1:A|pdbid|entity|chain(s)|sequence                                40   7e-04
2OHA:1:A|pdbid|entity|chain(s)|sequence                                40   7e-04
2EF2:1:A|pdbid|entity|chain(s)|sequence                                40   7e-04
1V9Q:1:A|pdbid|entity|chain(s)|sequence                                40   7e-04
1UFJ:1:A|pdbid|entity|chain(s)|sequence                                40   7e-04
1J3F:1:A|pdbid|entity|chain(s)|sequence                                40   7e-04
1HSY:1:A|pdbid|entity|chain(s)|sequence                                40   7e-04
1BJE:1:A|pdbid|entity|chain(s)|sequence                                40   7e-04
2OHB:1:A|pdbid|entity|chain(s)|sequence                                40   0.001
1MLS:1:A|pdbid|entity|chain(s)|sequence                                40   0.001
1MLR:1:A|pdbid|entity|chain(s)|sequence                                40   0.001
1MLQ:1:A|pdbid|entity|chain(s)|sequence                                40   0.001
2SPO:1:A|pdbid|entity|chain(s)|sequence                                40   0.001
1CP0:1:A|pdbid|entity|chain(s)|sequence                                40   0.001
1CO8:1:A|pdbid|entity|chain(s)|sequence                                40   0.001
2SPN:1:A|pdbid|entity|chain(s)|sequence                                40   0.001
2SPM:1:A|pdbid|entity|chain(s)|sequence                                40   0.001
2SPL:1:A|pdbid|entity|chain(s)|sequence                                40   0.001
2G14:1:A|pdbid|entity|chain(s)|sequence                                40   0.001
2G12:1:A|pdbid|entity|chain(s)|sequence                                40   0.001
2G11:1:A|pdbid|entity|chain(s)|sequence                                40   0.001
2G10:1:A|pdbid|entity|chain(s)|sequence                                40   0.001
2G0Z:1:A|pdbid|entity|chain(s)|sequence                                40   0.001
2G0X:1:A|pdbid|entity|chain(s)|sequence                                40   0.001
2G0V:1:A|pdbid|entity|chain(s)|sequence                                40   0.001
2G0S:1:A|pdbid|entity|chain(s)|sequence                                40   0.001
2G0R:1:A|pdbid|entity|chain(s)|sequence                                40   0.001
1MOA:1:A|pdbid|entity|chain(s)|sequence                                40   0.001
1JDO:1:A|pdbid|entity|chain(s)|sequence                                40   0.001
1CH2:1:A|pdbid|entity|chain(s)|sequence                                40   0.001
1CIK:1:A|pdbid|entity|chain(s)|sequence                                40   0.001
1MLL:1:A|pdbid|entity|chain(s)|sequence                                39   0.001
1MLK:1:A|pdbid|entity|chain(s)|sequence                                39   0.001
1MLJ:1:A|pdbid|entity|chain(s)|sequence                                39   0.001
108M:1:A|pdbid|entity|chain(s)|sequence                                39   0.001
107M:1:A|pdbid|entity|chain(s)|sequence                                39   0.001
106M:1:A|pdbid|entity|chain(s)|sequence                                39   0.001
1MLH:1:A|pdbid|entity|chain(s)|sequence                                39   0.001
1MLG:1:A|pdbid|entity|chain(s)|sequence                                39   0.001
1MLF:1:A|pdbid|entity|chain(s)|sequence                                39   0.001
1FCS:1:A|pdbid|entity|chain(s)|sequence                                39   0.001
2BWH:1:A|pdbid|entity|chain(s)|sequence                                39   0.002
2BW9:1:M|pdbid|entity|chain(s)|sequence                                39   0.002
2BLJ:1:M|pdbid|entity|chain(s)|sequence                                39   0.002
2BLI:1:A|pdbid|entity|chain(s)|sequence                                39   0.002
2BLH:1:A|pdbid|entity|chain(s)|sequence                                39   0.002
1MGN:1:A|pdbid|entity|chain(s)|sequence                                39   0.002
1LTW:1:A|pdbid|entity|chain(s)|sequence                                39   0.002
1DO7:1:A|pdbid|entity|chain(s)|sequence                                39   0.002
1DO4:1:A|pdbid|entity|chain(s)|sequence                                39   0.002
1DO3:1:A|pdbid|entity|chain(s)|sequence                                39   0.002
1DO1:1:A|pdbid|entity|chain(s)|sequence                                39   0.002
1CH3:1:A|pdbid|entity|chain(s)|sequence                                39   0.002
1MTI:1:A|pdbid|entity|chain(s)|sequence                                39   0.002
4IT8:1:A|pdbid|entity|chain(s)|sequence                                39   0.002
4H0B:1:A|pdbid|entity|chain(s)|sequence                                39   0.002
4H07:1:A|pdbid|entity|chain(s)|sequence                                39   0.002
3O89:1:A|pdbid|entity|chain(s)|sequence                                39   0.002
2MGH:1:A|pdbid|entity|chain(s)|sequence                                39   0.002
2MGG:1:A|pdbid|entity|chain(s)|sequence                                39   0.002
2MGF:1:A|pdbid|entity|chain(s)|sequence                                39   0.002
2W6Y:1:A|pdbid|entity|chain(s)|sequence                                39   0.002
2OH9:1:A|pdbid|entity|chain(s)|sequence                                39   0.002
1MYM:1:A|pdbid|entity|chain(s)|sequence                                39   0.003
1MTK:1:A|pdbid|entity|chain(s)|sequence                                39   0.003
1MTJ:1:A|pdbid|entity|chain(s)|sequence                                39   0.003
101M:1:A|pdbid|entity|chain(s)|sequence                                39   0.003
1IRC:1:A|pdbid|entity|chain(s)|sequence                                39   0.003
3OGB:1:A|pdbid|entity|chain(s)|sequence                                38   0.003
3NML:1:A|pdbid|entity|chain(s)|sequence                                38   0.003
1CH1:1:A|pdbid|entity|chain(s)|sequence                                38   0.003
2W6X:1:A|pdbid|entity|chain(s)|sequence                                38   0.003
3SDN:1:A|pdbid|entity|chain(s)|sequence                                38   0.003
2EVP:1:A|pdbid|entity|chain(s)|sequence                                38   0.003
2EVK:1:A|pdbid|entity|chain(s)|sequence                                38   0.003
1DUO:1:A|pdbid|entity|chain(s)|sequence                                38   0.003
1DTM:1:A|pdbid|entity|chain(s)|sequence                                38   0.003
2MGB:1:A|pdbid|entity|chain(s)|sequence                                38   0.003
2MGA:1:A|pdbid|entity|chain(s)|sequence                                38   0.003
1MOB:1:A|pdbid|entity|chain(s)|sequence                                38   0.003
1NAZ:1:A|pdbid|entity|chain(s)|sequence                                38   0.003
1N9X:1:A|pdbid|entity|chain(s)|sequence                                38   0.003
1N9I:1:A|pdbid|entity|chain(s)|sequence                                38   0.003
1N9H:1:A|pdbid|entity|chain(s)|sequence                                38   0.003
1N9F:1:A|pdbid|entity|chain(s)|sequence                                38   0.003
1MZ0:1:A|pdbid|entity|chain(s)|sequence                                38   0.003
1MYZ:1:A|pdbid|entity|chain(s)|sequence                                38   0.003
1MCY:1:A|pdbid|entity|chain(s)|sequence                                38   0.003
1F65:1:A|pdbid|entity|chain(s)|sequence                                38   0.003
1F63:1:A|pdbid|entity|chain(s)|sequence                                38   0.003
1DXD:1:A|pdbid|entity|chain(s)|sequence                                38   0.003
1DXC:1:A|pdbid|entity|chain(s)|sequence                                38   0.003
1HLB:1:A|pdbid|entity|chain(s)|sequence                                38   0.004
2MGJ:1:A|pdbid|entity|chain(s)|sequence                                38   0.004
2MGE:1:A|pdbid|entity|chain(s)|sequence                                38   0.004
2MGD:1:A|pdbid|entity|chain(s)|sequence                                38   0.004
2MGC:1:A|pdbid|entity|chain(s)|sequence                                38   0.004
103M:1:A|pdbid|entity|chain(s)|sequence                                38   0.004
102M:1:A|pdbid|entity|chain(s)|sequence                                38   0.004
2MGI:1:A|pdbid|entity|chain(s)|sequence                                38   0.004
1MOD:1:A|pdbid|entity|chain(s)|sequence                                38   0.004
1MOC:1:A|pdbid|entity|chain(s)|sequence                                38   0.004
1EMY:1:A|pdbid|entity|chain(s)|sequence                                38   0.004
4LPI:1:A|pdbid|entity|chain(s)|sequence                                38   0.005
1O16:1:A|pdbid|entity|chain(s)|sequence                                37   0.005
3S1J:1:A,B,C|pdbid|entity|chain(s)|sequence                            37   0.008
3S1I:1:A,B,C|pdbid|entity|chain(s)|sequence                            37   0.008
1LUE:1:A|pdbid|entity|chain(s)|sequence                                37   0.009
3MN0:1:A|pdbid|entity|chain(s)|sequence                                37   0.009
3UBV:1:A,D,G|pdbid|entity|chain(s)|sequence                            37   0.010
3UBC:1:A,D,G|pdbid|entity|chain(s)|sequence                            37   0.010
1MLU:1:A|pdbid|entity|chain(s)|sequence                                37   0.011
4FWZ:1:A|pdbid|entity|chain(s)|sequence                                36   0.012
2E2Y:1:A|pdbid|entity|chain(s)|sequence                                36   0.015
3H58:1:A|pdbid|entity|chain(s)|sequence                                36   0.016
3H57:1:A|pdbid|entity|chain(s)|sequence                                36   0.016
1OBM:1:A|pdbid|entity|chain(s)|sequence                                36   0.019
1OFJ:1:A|pdbid|entity|chain(s)|sequence                                35   0.023
2C0K:1:A,B|pdbid|entity|chain(s)|sequence                              35   0.025
1OFK:1:A|pdbid|entity|chain(s)|sequence                                35   0.026
4FWY:1:A|pdbid|entity|chain(s)|sequence                                35   0.027
4FWX:1:A|pdbid|entity|chain(s)|sequence                                35   0.027
1YHU:1:A,E,I,M,Q,U|pdbid|entity|chain(s)|sequence                      35   0.027
4MXL:1:A|pdbid|entity|chain(s)|sequence                                34   0.061
4MXK:1:A|pdbid|entity|chain(s)|sequence                                34   0.061
3K9Z:1:A|pdbid|entity|chain(s)|sequence                                34   0.061
3M3B:1:A|pdbid|entity|chain(s)|sequence                                32   0.19 
3M3A:1:A|pdbid|entity|chain(s)|sequence                                32   0.19 
3M39:1:A|pdbid|entity|chain(s)|sequence                                32   0.19 
3M38:1:A|pdbid|entity|chain(s)|sequence                                32   0.19 
1W92:1:A|pdbid|entity|chain(s)|sequence                                32   0.21 
1Q1F:1:A|pdbid|entity|chain(s)|sequence                                32   0.21 
3GLN:1:A|pdbid|entity|chain(s)|sequence                                32   0.26 
3GKT:1:A|pdbid|entity|chain(s)|sequence                                32   0.26 
3GK9:1:A|pdbid|entity|chain(s)|sequence                                32   0.26 
2VRY:1:A|pdbid|entity|chain(s)|sequence                                32   0.26 
4MU5:1:A|pdbid|entity|chain(s)|sequence                                32   0.27 
1YHU:3:C,G,K,O,S,W|pdbid|entity|chain(s)|sequence                      32   0.34 
4IT1:1:A,B,C,D|pdbid|entity|chain(s)|sequence                          30   0.70 
3U7B:1:A,B,C,D,E|pdbid|entity|chain(s)|sequence                        28   3.9  
1B0B:1:A|pdbid|entity|chain(s)|sequence                                28   4.4  
3KYH:1:A,B|pdbid|entity|chain(s)|sequence                              27   7.3  
1D8I:1:A,B,C|pdbid|entity|chain(s)|sequence                            27   7.6  
1D8H:1:A,B,C|pdbid|entity|chain(s)|sequence                            27   7.6  
>1O1N:1:A|pdbid|entity|chain(s)|sequence
          Length = 285

 Score =  251 bits (641), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 140/141 (99%), Positives = 140/141 (99%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEA ERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 145 VLSPADKTNVKAAWGKVGAHAGEYGAEAWERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 204

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 205 KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 264

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 265 VHASLDKFLASVSTVLTSKYR 285

 Score =  250 bits (638), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 139/141 (98%), Positives = 140/141 (99%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           +LSPADKTNVKAAWGKVGAHAGEYGAEA ERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEAWERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1C7D:1:A|pdbid|entity|chain(s)|sequence
          Length = 284

 Score =  251 bits (640), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 144 VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 203

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 204 KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 263

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 264 VHASLDKFLASVSTVLTSKYR 284

 Score =  250 bits (638), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 140/141 (99%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           +LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1Z8U:2:B,D|pdbid|entity|chain(s)|sequence
          Length = 142

 Score =  250 bits (639), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 2   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 61

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 62  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 121

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 122 VHASLDKFLASVSTVLTSKYR 142
>1Y01:2:B|pdbid|entity|chain(s)|sequence
          Length = 142

 Score =  250 bits (639), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 2   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 61

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 62  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 121

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 122 VHASLDKFLASVSTVLTSKYR 142
>1O1P:1:A|pdbid|entity|chain(s)|sequence
          Length = 283

 Score =  250 bits (639), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 143 VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 202

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 203 KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 262

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 263 VHASLDKFLASVSTVLTSKYR 283

 Score =  249 bits (637), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 140/141 (99%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           +LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1C7C:1:A|pdbid|entity|chain(s)|sequence
          Length = 283

 Score =  250 bits (639), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 143 VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 202

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 203 KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 262

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 263 VHASLDKFLASVSTVLTSKYR 283

 Score =  249 bits (637), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 140/141 (99%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           +LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1BZ1:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 142

 Score =  250 bits (639), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 2   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 61

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 62  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 121

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 122 VHASLDKFLASVSTVLTSKYR 142
>1ABY:1:A|pdbid|entity|chain(s)|sequence
          Length = 283

 Score =  250 bits (639), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 143 VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 202

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 203 KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 262

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 263 VHASLDKFLASVSTVLTSKYR 283

 Score =  249 bits (637), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 140/141 (99%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           +LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1ABW:1:A|pdbid|entity|chain(s)|sequence
          Length = 283

 Score =  250 bits (639), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 143 VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 202

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 203 KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 262

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 263 VHASLDKFLASVSTVLTSKYR 283

 Score =  249 bits (637), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 140/141 (99%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           +LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1O1M:1:A|pdbid|entity|chain(s)|sequence
          Length = 285

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 139/141 (98%), Positives = 139/141 (98%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEA ERMFLSFPTTKTYFPHFDLSHGSAQVKG GK
Sbjct: 145 VLSPADKTNVKAAWGKVGAHAGEYGAEAFERMFLSFPTTKTYFPHFDLSHGSAQVKGQGK 204

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 205 KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 264

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 265 VHASLDKFLASVSTVLTSKYR 285

 Score =  249 bits (635), Expect = 8e-67,   Method: Composition-based stats.
 Identities = 138/141 (97%), Positives = 139/141 (98%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           +LSPADKTNVKAAWGKVGAHAGEYGAEA ERMFLSFPTTKTYFPHFDLSHGSAQVKG GK
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEAFERMFLSFPTTKTYFPHFDLSHGSAQVKGQGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>6HBW:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>4N7P:1:A,C,E,G,I,K|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>4N7O:1:A,C,E,G,I,K|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>4N7N:1:A,C,E,G,I,K|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>4MQK:1:A,C,E,G|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>4MQJ:1:A,C,E,G|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>4MQG:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>4M4B:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>4M4A:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>4L7Y:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>4IJ2:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>4HHB:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>4FC3:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>3WCP:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>3SZK:1:A,D|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>3S66:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>3S65:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>3S48:2:C,D|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>3R5I:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>3QJE:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>3QJC:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>3P5Q:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>3OVU:3:C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>3OO5:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>3OO4:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>3ONZ:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>3ODQ:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>3NL7:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>3KMF:1:A,E|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>3IC2:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>3IC0:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>3HXN:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>3HHB:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>3DUT:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>3D7O:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>3D17:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>3B75:1:A,C,E,G,S|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>2YRS:1:A,C,I,M|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>2W6V:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>2M6Z:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>2HHE:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>2HHD:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>2HHB:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>2HCO:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>2HBS:1:A,C,E,G|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>2HBF:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>2HBE:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>2HBD:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>2HBC:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>2H35:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>2DXM:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>2DN3:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>2DN2:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>2DN1:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>2D60:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>2D5Z:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1YZI:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1YVT:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1YVQ:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1YIH:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1YIE:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1YHR:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1YHE:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1YH9:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1YGF:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1YGD:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1YG5:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1YFF:1:A,C,E,G|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1YEV:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1YEU:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1YEQ:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1YEO:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1YEN:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1YE2:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1YE1:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1YE0:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1Y85:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1Y83:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1Y7Z:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1Y7G:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1Y7D:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1Y7C:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1Y5K:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1Y5J:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1Y5F:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1Y4V:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1Y4R:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1Y4Q:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1Y4P:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1Y4G:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1Y4F:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1Y4B:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1Y46:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1Y45:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1Y35:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1Y31:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1Y2Z:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1Y22:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1Y0W:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1Y0T:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1XZ2:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1XXT:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1UIW:1:A,C,E,G|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1THB:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1SI4:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1SHR:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1SDL:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1SDK:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1RQA:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1RQ4:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1RQ3:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1RPS:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1QXE:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1QXD:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1QSI:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1QSH:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1NQP:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1NIH:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1NEJ:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1MKO:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1M9P:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1LJW:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1LFZ:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1LFY:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1LFV:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1LFT:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1LFQ:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1LFL:1:A,C,P,R|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1KD2:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1K1K:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1K0Y:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1JY7:1:A,C,P,R,U,W|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1J41:1:A,C,E,G|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1J40:1:A,C,E,G|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1J3Z:1:A,C,E,G|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1J3Y:1:A,C,E,G|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1IRD:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1HHO:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1HGC:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1HGB:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1HGA:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1HDB:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1HCO:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1HBS:1:A,C,E,G|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1HBB:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1HBA:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1HAC:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1HAB:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1GZX:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1GBV:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1GBU:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1G9V:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1FN3:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1FDH:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1DXV:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1DXU:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1DXT:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1DKE:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1COH:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1CMY:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1CLS:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1BZ0:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1BUW:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1BIJ:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1BBB:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1B86:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1A9W:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1A3N:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1A0Z:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1A0U:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1A01:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1A00:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  250 bits (638), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>3IA3:2:B,D|pdbid|entity|chain(s)|sequence
          Length = 145

 Score =  249 bits (637), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 5   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 64

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 65  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 124

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 125 VHASLDKFLASVSTVLTSKYR 145
>1BAB:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 143

 Score =  249 bits (637), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 140/140 (100%), Positives = 140/140 (100%)

Query: 2   LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKK 61
           LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKK
Sbjct: 4   LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKK 63

Query: 62  VADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAV 121
           VADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAV
Sbjct: 64  VADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAV 123

Query: 122 HASLDKFLASVSTVLTSKYR 141
           HASLDKFLASVSTVLTSKYR
Sbjct: 124 HASLDKFLASVSTVLTSKYR 143
>1AJ9:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  249 bits (637), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 140/141 (99%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGS+QVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSSQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1O1L:1:A|pdbid|entity|chain(s)|sequence
          Length = 283

 Score =  249 bits (637), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 139/141 (98%), Positives = 139/141 (98%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEA ERMFLSFPTTKTYFPHFDLSHGSAQVKG GK
Sbjct: 143 VLSPADKTNVKAAWGKVGAHAGEYGAEAWERMFLSFPTTKTYFPHFDLSHGSAQVKGQGK 202

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 203 KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 262

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 263 VHASLDKFLASVSTVLTSKYR 283

 Score =  248 bits (634), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 138/141 (97%), Positives = 139/141 (98%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           +LSPADKTNVKAAWGKVGAHAGEYGAEA ERMFLSFPTTKTYFPHFDLSHGSAQVKG GK
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEAWERMFLSFPTTKTYFPHFDLSHGSAQVKGQGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>3NMM:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  249 bits (637), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 140/141 (99%), Positives = 140/141 (99%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKG GK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGWGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1VWT:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  249 bits (636), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 140/141 (99%), Positives = 140/141 (99%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDP NFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPWNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1RVW:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  249 bits (636), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 140/141 (99%), Positives = 140/141 (99%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDP NFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPWNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1O1J:1:A|pdbid|entity|chain(s)|sequence
          Length = 283

 Score =  249 bits (636), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 139/141 (98%), Positives = 139/141 (98%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEA ERMFLSFPTTKTYFPHFDLSHGSAQVKG GK
Sbjct: 143 VLSPADKTNVKAAWGKVGAHAGEYGAEAFERMFLSFPTTKTYFPHFDLSHGSAQVKGQGK 202

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 203 KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 262

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 263 VHASLDKFLASVSTVLTSKYR 283

 Score =  248 bits (633), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 138/141 (97%), Positives = 139/141 (98%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           +LSPADKTNVKAAWGKVGAHAGEYGAEA ERMFLSFPTTKTYFPHFDLSHGSAQVKG GK
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEAFERMFLSFPTTKTYFPHFDLSHGSAQVKGQGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>4MQC:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  249 bits (635), Expect = 9e-67,   Method: Composition-based stats.
 Identities = 140/141 (99%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           K+ADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KMADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1O1K:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  249 bits (635), Expect = 9e-67,   Method: Composition-based stats.
 Identities = 140/141 (99%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           +LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1J7W:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  249 bits (635), Expect = 9e-67,   Method: Composition-based stats.
 Identities = 140/141 (99%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           +LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1C7B:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  249 bits (635), Expect = 9e-67,   Method: Composition-based stats.
 Identities = 140/141 (99%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           +LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1BZZ:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  249 bits (635), Expect = 9e-67,   Method: Composition-based stats.
 Identities = 140/141 (99%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           +LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1GLI:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  248 bits (634), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 139/141 (98%), Positives = 140/141 (99%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           +LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFP TKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPWTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>2W72:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  248 bits (633), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 139/141 (98%), Positives = 139/141 (98%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEA ERMFLSFPTTKTYFPHFDLSHGSAQVKG GK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEAYERMFLSFPTTKTYFPHFDLSHGSAQVKGQGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>3QJD:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  248 bits (633), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 140/141 (99%), Positives = 140/141 (99%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKG GK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGLGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>3QJB:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  248 bits (633), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 140/141 (99%), Positives = 140/141 (99%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKG GK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGLGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1O1I:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  248 bits (633), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 138/141 (97%), Positives = 139/141 (98%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           +LSPADKTNVKAAWGKVGAHAGEYGAEA ERMFLSFPTTKTYFPHFDLSHGSAQVKG GK
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEAFERMFLSFPTTKTYFPHFDLSHGSAQVKGQGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1O1O:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  248 bits (633), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 139/141 (98%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           +LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           K+ADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KLADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1YDZ:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  248 bits (632), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 139/141 (98%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           +LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSK+R
Sbjct: 121 VHASLDKFLASVSTVLTSKFR 141
>1Y0C:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  248 bits (632), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 139/141 (98%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           +LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSK+R
Sbjct: 121 VHASLDKFLASVSTVLTSKFR 141
>1XY0:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  248 bits (632), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 139/141 (98%), Positives = 140/141 (99%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           +LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTT TYFPHFDLSHGSAQVKGHGK
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTGTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>2W72:3:C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  247 bits (631), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 138/141 (97%), Positives = 139/141 (98%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           +LSPADKTNVKAAWGKVGAHAGEYGAEA ERMFLSFPTTKTYFPHFDLSHGSAQVKG GK
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEAYERMFLSFPTTKTYFPHFDLSHGSAQVKGQGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1QI8:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  247 bits (631), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 138/141 (97%), Positives = 139/141 (98%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           +LSPADKTNVKAAWGKVGAHAGEYGAEA ERMFLSFPTTKTYFPHFDLSHGSAQVKG GK
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEAYERMFLSFPTTKTYFPHFDLSHGSAQVKGQGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1J7Y:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  247 bits (631), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 138/141 (97%), Positives = 139/141 (98%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           +LSPADKTNVKAAWGKVGAHAGEYGAEA ERMFLSFPTTKTYFPHFDLSHGSAQVKG GK
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEAYERMFLSFPTTKTYFPHFDLSHGSAQVKGQGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1J7S:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  247 bits (631), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 138/141 (97%), Positives = 139/141 (98%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           +LSPADKTNVKAAWGKVGAHAGEYGAEA ERMFLSFPTTKTYFPHFDLSHGSAQVKG GK
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEAYERMFLSFPTTKTYFPHFDLSHGSAQVKGQGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>4MQI:1:A|pdbid|entity|chain(s)|sequence
          Length = 140

 Score =  247 bits (631), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 140/140 (100%), Positives = 140/140 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKY 140
           VHASLDKFLASVSTVLTSKY
Sbjct: 121 VHASLDKFLASVSTVLTSKY 140
>1Y0D:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 140

 Score =  247 bits (631), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 140/140 (100%), Positives = 140/140 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKY 140
           VHASLDKFLASVSTVLTSKY
Sbjct: 121 VHASLDKFLASVSTVLTSKY 140
>1XZU:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  247 bits (630), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 139/141 (98%), Positives = 140/141 (99%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           +LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRV PVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVGPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1A3O:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  246 bits (629), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 140/141 (99%), Positives = 141/141 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKT+FPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTHFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1XZ5:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  246 bits (628), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 139/141 (98%), Positives = 140/141 (99%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           +LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHK RVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKARVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1R1Y:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  246 bits (627), Expect = 7e-66,   Method: Composition-based stats.
 Identities = 140/141 (99%), Positives = 140/141 (99%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRV PVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVAPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1R1X:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  246 bits (627), Expect = 7e-66,   Method: Composition-based stats.
 Identities = 140/141 (99%), Positives = 140/141 (99%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRV PVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVAPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1XZV:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  245 bits (626), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 139/141 (98%), Positives = 140/141 (99%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           +LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVD VNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDAVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1Y09:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  245 bits (625), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 139/141 (98%), Positives = 140/141 (99%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           +LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPV FKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVAFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1Y8W:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  245 bits (625), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 139/141 (98%), Positives = 140/141 (99%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           +LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKL VDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLAVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1XZ7:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  245 bits (625), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 139/141 (98%), Positives = 140/141 (99%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           +LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKL VDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLAVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1Y0A:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  244 bits (624), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 139/141 (98%), Positives = 140/141 (99%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           +LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSK R
Sbjct: 121 VHASLDKFLASVSTVLTSKAR 141
>1XZ4:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  244 bits (624), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 139/141 (98%), Positives = 140/141 (99%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           +LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKT FPHFDLSHGSAQVKGHGK
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTAFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>1XYE:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  244 bits (624), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 139/141 (98%), Positives = 140/141 (99%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           +LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKT FPHFDLSHGSAQVKGHGK
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTAFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>4MQH:1:A|pdbid|entity|chain(s)|sequence
          Length = 139

 Score =  243 bits (621), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 138/139 (99%), Positives = 139/139 (100%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           K+ADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
Sbjct: 61  KMADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSK 139
           VHASLDKFLASVSTVLTSK
Sbjct: 121 VHASLDKFLASVSTVLTSK 139
>3FH9:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  230 bits (586), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 122/141 (86%), Positives = 132/141 (93%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLS  DK+NVKAAW KVG + GEYGAEALERMFLSFPTTKTYFPHFDL+HGS+QVK HGK
Sbjct: 1   VLSSTDKSNVKAAWDKVGGNVGEYGAEALERMFLSFPTTKTYFPHFDLAHGSSQVKAHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KV DALTNAV H+DD+P ALSALSDLHA+KLRVDPVNFKLLSHCLLVTLA+HLP++FTPA
Sbjct: 61  KVGDALTNAVGHIDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLASHLPSDFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>2D5X:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  226 bits (576), Expect = 7e-60,   Method: Composition-based stats.
 Identities = 124/141 (87%), Positives = 128/141 (90%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLS ADKTNVKAAW KVG HAGEYGAEALERMFL FPTTKTYFPHFDLSHGSAQVK HGK
Sbjct: 1   VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KV DALT AV H+DD+P ALS LSDLHAHKLRVDPVNFKLLSHCLL TLA HLP +FTPA
Sbjct: 61  KVGDALTLAVGHLDDLPGALSNLSDLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFL+SVSTVLTSKYR
Sbjct: 121 VHASLDKFLSSVSTVLTSKYR 141
>1IWH:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  226 bits (576), Expect = 7e-60,   Method: Composition-based stats.
 Identities = 124/141 (87%), Positives = 128/141 (90%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLS ADKTNVKAAW KVG HAGEYGAEALERMFL FPTTKTYFPHFDLSHGSAQVK HGK
Sbjct: 1   VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KV DALT AV H+DD+P ALS LSDLHAHKLRVDPVNFKLLSHCLL TLA HLP +FTPA
Sbjct: 61  KVGDALTLAVGHLDDLPGALSNLSDLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFL+SVSTVLTSKYR
Sbjct: 121 VHASLDKFLSSVSTVLTSKYR 141
>3LQD:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  226 bits (575), Expect = 9e-60,   Method: Composition-based stats.
 Identities = 117/141 (82%), Positives = 129/141 (91%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTN+K AW K+G+H GEYGAEA+ERMFL FPTTKTYFPHFD +HGS Q+K HGK
Sbjct: 1   VLSPADKTNIKTAWEKIGSHGGEYGAEAVERMFLGFPTTKTYFPHFDFTHGSEQIKAHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KV++ALT AV H+DD+P ALSALSDLHAHKLRVDPVNFKLLSHCLLVTLA H P+EFTPA
Sbjct: 61  KVSEALTKAVGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLANHHPSEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLA+VSTVLTSKYR
Sbjct: 121 VHASLDKFLANVSTVLTSKYR 141
>2RAO:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  225 bits (573), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 116/141 (82%), Positives = 128/141 (90%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTN+K AW K+G+H GEYGAEA+ERMFL FPTTKTYFPHFD +HGS Q+K HGK
Sbjct: 1   VLSPADKTNIKTAWEKIGSHGGEYGAEAVERMFLGFPTTKTYFPHFDFTHGSEQIKAHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KV++ALT AV H+DD+P ALS LSDLHAHKLRVDPVNFKLLSHCLLVTLA H P+EFTPA
Sbjct: 61  KVSEALTKAVGHLDDLPGALSTLSDLHAHKLRVDPVNFKLLSHCLLVTLANHHPSEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLA+VSTVLTSKYR
Sbjct: 121 VHASLDKFLANVSTVLTSKYR 141
>2ZLX:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  224 bits (571), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 123/141 (87%), Positives = 128/141 (90%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLS ADKTNVKAAW KVG HAGEYGAEALERMFL FPTTKTYFPHFDLSHGSAQVK HGK
Sbjct: 1   VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KV DALT AV H+DD+P ALS LS+LHAHKLRVDPVNFKLLSHCLL TLA HLP +FTPA
Sbjct: 61  KVGDALTLAVGHLDDLPGALSDLSNLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFL+SVSTVLTSKYR
Sbjct: 121 VHASLDKFLSSVSTVLTSKYR 141
>2ZLW:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  224 bits (571), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 123/141 (87%), Positives = 128/141 (90%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLS ADKTNVKAAW KVG HAGEYGAEALERMFL FPTTKTYFPHFDLSHGSAQVK HGK
Sbjct: 1   VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KV DALT AV H+DD+P ALS LS+LHAHKLRVDPVNFKLLSHCLL TLA HLP +FTPA
Sbjct: 61  KVGDALTLAVGHLDDLPGALSDLSNLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFL+SVSTVLTSKYR
Sbjct: 121 VHASLDKFLSSVSTVLTSKYR 141
>2ZLV:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  224 bits (571), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 123/141 (87%), Positives = 128/141 (90%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLS ADKTNVKAAW KVG HAGEYGAEALERMFL FPTTKTYFPHFDLSHGSAQVK HGK
Sbjct: 1   VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KV DALT AV H+DD+P ALS LS+LHAHKLRVDPVNFKLLSHCLL TLA HLP +FTPA
Sbjct: 61  KVGDALTLAVGHLDDLPGALSDLSNLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFL+SVSTVLTSKYR
Sbjct: 121 VHASLDKFLSSVSTVLTSKYR 141
>2ZLU:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  224 bits (571), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 123/141 (87%), Positives = 128/141 (90%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLS ADKTNVKAAW KVG HAGEYGAEALERMFL FPTTKTYFPHFDLSHGSAQVK HGK
Sbjct: 1   VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KV DALT AV H+DD+P ALS LS+LHAHKLRVDPVNFKLLSHCLL TLA HLP +FTPA
Sbjct: 61  KVGDALTLAVGHLDDLPGALSDLSNLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFL+SVSTVLTSKYR
Sbjct: 121 VHASLDKFLSSVSTVLTSKYR 141
>2ZLT:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  224 bits (571), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 123/141 (87%), Positives = 128/141 (90%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLS ADKTNVKAAW KVG HAGEYGAEALERMFL FPTTKTYFPHFDLSHGSAQVK HGK
Sbjct: 1   VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KV DALT AV H+DD+P ALS LS+LHAHKLRVDPVNFKLLSHCLL TLA HLP +FTPA
Sbjct: 61  KVGDALTLAVGHLDDLPGALSDLSNLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFL+SVSTVLTSKYR
Sbjct: 121 VHASLDKFLSSVSTVLTSKYR 141
>2MHB:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  224 bits (571), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 123/141 (87%), Positives = 128/141 (90%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLS ADKTNVKAAW KVG HAGEYGAEALERMFL FPTTKTYFPHFDLSHGSAQVK HGK
Sbjct: 1   VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KV DALT AV H+DD+P ALS LS+LHAHKLRVDPVNFKLLSHCLL TLA HLP +FTPA
Sbjct: 61  KVGDALTLAVGHLDDLPGALSDLSNLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFL+SVSTVLTSKYR
Sbjct: 121 VHASLDKFLSSVSTVLTSKYR 141
>2DHB:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  224 bits (571), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 123/141 (87%), Positives = 128/141 (90%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLS ADKTNVKAAW KVG HAGEYGAEALERMFL FPTTKTYFPHFDLSHGSAQVK HGK
Sbjct: 1   VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVAD LT AV H+DD+P ALS LS+LHAHKLRVDPVNFKLLSHCLL TLA HLP +FTPA
Sbjct: 61  KVADGLTLAVGHLDDLPGALSDLSNLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFL+SVSTVLTSKYR
Sbjct: 121 VHASLDKFLSSVSTVLTSKYR 141
>1Y8K:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  224 bits (571), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 123/141 (87%), Positives = 128/141 (90%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLS ADKTNVKAAW KVG HAGEYGAEALERMFL FPTTKTYFPHFDLSHGSAQVK HGK
Sbjct: 1   VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KV DALT AV H+DD+P ALS LS+LHAHKLRVDPVNFKLLSHCLL TLA HLP +FTPA
Sbjct: 61  KVGDALTLAVGHLDDLPGALSDLSNLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFL+SVSTVLTSKYR
Sbjct: 121 VHASLDKFLSSVSTVLTSKYR 141
>1Y8I:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  224 bits (571), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 123/141 (87%), Positives = 128/141 (90%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLS ADKTNVKAAW KVG HAGEYGAEALERMFL FPTTKTYFPHFDLSHGSAQVK HGK
Sbjct: 1   VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KV DALT AV H+DD+P ALS LS+LHAHKLRVDPVNFKLLSHCLL TLA HLP +FTPA
Sbjct: 61  KVGDALTLAVGHLDDLPGALSDLSNLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFL+SVSTVLTSKYR
Sbjct: 121 VHASLDKFLSSVSTVLTSKYR 141
>1Y8H:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  224 bits (571), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 123/141 (87%), Positives = 128/141 (90%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLS ADKTNVKAAW KVG HAGEYGAEALERMFL FPTTKTYFPHFDLSHGSAQVK HGK
Sbjct: 1   VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KV DALT AV H+DD+P ALS LS+LHAHKLRVDPVNFKLLSHCLL TLA HLP +FTPA
Sbjct: 61  KVGDALTLAVGHLDDLPGALSDLSNLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFL+SVSTVLTSKYR
Sbjct: 121 VHASLDKFLSSVSTVLTSKYR 141
>1NS9:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  224 bits (571), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 123/141 (87%), Positives = 128/141 (90%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLS ADKTNVKAAW KVG HAGEYGAEALERMFL FPTTKTYFPHFDLSHGSAQVK HGK
Sbjct: 1   VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KV DALT AV H+DD+P ALS LS+LHAHKLRVDPVNFKLLSHCLL TLA HLP +FTPA
Sbjct: 61  KVGDALTLAVGHLDDLPGALSDLSNLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFL+SVSTVLTSKYR
Sbjct: 121 VHASLDKFLSSVSTVLTSKYR 141
>1NS6:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  224 bits (571), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 123/141 (87%), Positives = 128/141 (90%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLS ADKTNVKAAW KVG HAGEYGAEALERMFL FPTTKTYFPHFDLSHGSAQVK HGK
Sbjct: 1   VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KV DALT AV H+DD+P ALS LS+LHAHKLRVDPVNFKLLSHCLL TLA HLP +FTPA
Sbjct: 61  KVGDALTLAVGHLDDLPGALSDLSNLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFL+SVSTVLTSKYR
Sbjct: 121 VHASLDKFLSSVSTVLTSKYR 141
>1G0B:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  224 bits (571), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 123/141 (87%), Positives = 128/141 (90%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLS ADKTNVKAAW KVG HAGEYGAEALERMFL FPTTKTYFPHFDLSHGSAQVK HGK
Sbjct: 1   VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KV DALT AV H+DD+P ALS LS+LHAHKLRVDPVNFKLLSHCLL TLA HLP +FTPA
Sbjct: 61  KVGDALTLAVGHLDDLPGALSDLSNLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFL+SVSTVLTSKYR
Sbjct: 121 VHASLDKFLSSVSTVLTSKYR 141
>1S0H:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  224 bits (570), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 122/141 (86%), Positives = 128/141 (90%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLS ADKTNVKAAW KVG +AGE+GAEALERMFL FPTTKTYFPHFDLSHGSAQVK HGK
Sbjct: 1   VLSAADKTNVKAAWSKVGGNAGEFGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KV DALT AV H+DD+P ALS LSDLHAHKLRVDPVNFKLLSHCLL TLA HLP +FTPA
Sbjct: 61  KVGDALTLAVGHLDDLPGALSNLSDLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFL+SVSTVLTSKYR
Sbjct: 121 VHASLDKFLSSVSTVLTSKYR 141
>3GYS:1:A,C,E,G|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  223 bits (569), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 120/141 (85%), Positives = 130/141 (92%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLS ADK+NVKA WGK+G+HAGEYGAEALER F SFPTTKTYFPHFDLSHGSAQVK HG+
Sbjct: 1   VLSAADKSNVKACWGKIGSHAGEYGAEALERTFCSFPTTKTYFPHFDLSHGSAQVKAHGQ 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALT AVAH+DD+P A+SALSDLHA+KLRVDPVNFK LSHCLLVTLA H PAEFTPA
Sbjct: 61  KVADALTQAVAHMDDLPTAMSALSDLHAYKLRVDPVNFKFLSHCLLVTLACHHPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKF ++VSTVLTSKYR
Sbjct: 121 VHASLDKFFSAVSTVLTSKYR 141
>3GQR:1:A,C,E,G|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  223 bits (569), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 120/141 (85%), Positives = 130/141 (92%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLS ADK+NVKA WGK+G+HAGEYGAEALER F SFPTTKTYFPHFDLSHGSAQVK HG+
Sbjct: 1   VLSAADKSNVKACWGKIGSHAGEYGAEALERTFCSFPTTKTYFPHFDLSHGSAQVKAHGQ 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALT AVAH+DD+P A+SALSDLHA+KLRVDPVNFK LSHCLLVTLA H PAEFTPA
Sbjct: 61  KVADALTQAVAHMDDLPTAMSALSDLHAYKLRVDPVNFKFLSHCLLVTLACHHPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKF ++VSTVLTSKYR
Sbjct: 121 VHASLDKFFSAVSTVLTSKYR 141
>3GQP:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  223 bits (569), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 120/141 (85%), Positives = 130/141 (92%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLS ADK+NVKA WGK+G+HAGEYGAEALER F SFPTTKTYFPHFDLSHGSAQVK HG+
Sbjct: 1   VLSAADKSNVKACWGKIGSHAGEYGAEALERTFCSFPTTKTYFPHFDLSHGSAQVKAHGQ 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALT AVAH+DD+P A+SALSDLHA+KLRVDPVNFK LSHCLLVTLA H PAEFTPA
Sbjct: 61  KVADALTQAVAHMDDLPTAMSALSDLHAYKLRVDPVNFKFLSHCLLVTLACHHPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKF ++VSTVLTSKYR
Sbjct: 121 VHASLDKFFSAVSTVLTSKYR 141
>3D4X:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  223 bits (569), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 120/141 (85%), Positives = 130/141 (92%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLS ADK+NVKA WGK+G+HAGEYGAEALER F SFPTTKTYFPHFDLSHGSAQVK HG+
Sbjct: 1   VLSAADKSNVKACWGKIGSHAGEYGAEALERTFCSFPTTKTYFPHFDLSHGSAQVKAHGQ 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADALT AVAH+DD+P A+SALSDLHA+KLRVDPVNFK LSHCLLVTLA H PAEFTPA
Sbjct: 61  KVADALTQAVAHMDDLPTAMSALSDLHAYKLRVDPVNFKFLSHCLLVTLACHHPAEFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKF ++VSTVLTSKYR
Sbjct: 121 VHASLDKFFSAVSTVLTSKYR 141
>1IBE:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  223 bits (568), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 122/141 (86%), Positives = 128/141 (90%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLS ADKTNVKAAW KVG HAGE+GAEALERMFL FPTTKTYFPHFDLSHGSAQVK HGK
Sbjct: 1   VLSAADKTNVKAAWSKVGGHAGEFGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KV DALT AV H+DD+P ALS LS+LHAHKLRVDPVNFKLLSHCLL TLA HLP +FTPA
Sbjct: 61  KVGDALTLAVGHLDDLPGALSDLSNLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFL+SVSTVLTSKYR
Sbjct: 121 VHASLDKFLSSVSTVLTSKYR 141
>3HRW:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  222 bits (566), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 121/141 (85%), Positives = 130/141 (92%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLS  DK+N+KAAWGK+G H  EYGAEALERMF SFPTTKTYFPHFD+SHGSAQVKGHGK
Sbjct: 1   VLSGEDKSNIKAAWGKIGGHGAEYGAEALERMFASFPTTKTYFPHFDVSHGSAQVKGHGK 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVADAL +A  H+DD+P ALSALSDLHAHKLRVDPVNFKLLSHCLLVTLA+H PA+FTPA
Sbjct: 61  KVADALASAAGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPADFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141
>3D1A:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 142

 Score =  222 bits (565), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 122/141 (86%), Positives = 129/141 (91%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLS ADK+NVKAAWGKVG +AG YGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG+
Sbjct: 2   VLSAADKSNVKAAWGKVGGNAGAYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGE 61

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVA ALT AV H+DD+P  LS LSDLHAHKLRVDPVNFKLLSH LLVTLA HLP +FTPA
Sbjct: 62  KVAAALTKAVGHLDDLPGTLSDLSDLHAHKLRVDPVNFKLLSHSLLVTLACHLPNDFTPA 121

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLA+VSTVLTSKYR
Sbjct: 122 VHASLDKFLANVSTVLTSKYR 142
>3EU1:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  221 bits (564), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 122/141 (86%), Positives = 129/141 (91%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLS ADK+NVKAAWGKVG +AG YGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG+
Sbjct: 1   VLSAADKSNVKAAWGKVGGNAGAYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGE 60

Query: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120
           KVA ALT AV H+DD+P  LS LSDLHAHKLRVDPVNFKLLSH LLVTLA HLP +FTPA
Sbjct: 61  KVAAALTKAVGHLDDLPGTLSDLSDLHAHKLRVDPVNFKLLSHSLLVTLACHLPNDFTPA 120

Query: 121 VHASLDKFLASVSTVLTSKYR 141
           VHASLDKFLA+VSTVLTSKYR
Sbjct: 121 VHASLDKFLANVSTVLTSKYR 141
  Database: pdb_polypeptide
    Posted date:  Jul 19, 2014  1:02 AM
  Number of letters in database: 34,350,227
  Number of sequences in database:  142,855
  
Lambda     K      H
   0.319    0.130    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 142855
Number of Hits to DB: 9,517,550
Number of extensions: 349195
Number of successful extensions: 2165
Number of sequences better than 10.0: 1058
Number of HSP's gapped: 1817
Number of HSP's successfully gapped: 1067
Length of query: 141
Length of database: 34,350,227
Length adjustment: 94
Effective length of query: 47
Effective length of database: 20,921,857
Effective search space: 983327279
Effective search space used: 983327279
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 57 (26.6 bits)