BLASTP 2.2.18 [Mar-02-2008]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics:
Schäffer, Alejandro A., L. Aravind, Thomas L. Madden, 
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= UNKNOWN_SEQUENCE
         (79 letters)

Database: pdb_polypeptide 
           146,201 sequences; 34,951,095 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1Z8U:2:B,D|pdbid|entity|chain(s)|sequence                             143   5e-35
1Y01:2:B|pdbid|entity|chain(s)|sequence                               143   5e-35
1VWT:1:A,C|pdbid|entity|chain(s)|sequence                             143   5e-35
1RVW:1:A|pdbid|entity|chain(s)|sequence                               143   5e-35
1BZ1:1:A,C|pdbid|entity|chain(s)|sequence                             143   5e-35
6HBW:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
4NI0:1:A|pdbid|entity|chain(s)|sequence                               143   6e-35
4N7P:1:A,C,E,G,I,K|pdbid|entity|chain(s)|sequence                     143   6e-35
4N7O:1:A,C,E,G,I,K|pdbid|entity|chain(s)|sequence                     143   6e-35
4N7N:1:A,C,E,G,I,K|pdbid|entity|chain(s)|sequence                     143   6e-35
4MQK:1:A,C,E,G|pdbid|entity|chain(s)|sequence                         143   6e-35
4MQJ:1:A,C,E,G|pdbid|entity|chain(s)|sequence                         143   6e-35
4MQG:1:A|pdbid|entity|chain(s)|sequence                               143   6e-35
4M4B:1:A|pdbid|entity|chain(s)|sequence                               143   6e-35
4M4A:1:A|pdbid|entity|chain(s)|sequence                               143   6e-35
4L7Y:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
4IJ2:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
4HHB:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
4FC3:1:A|pdbid|entity|chain(s)|sequence                               143   6e-35
3WCP:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
3SZK:1:A,D|pdbid|entity|chain(s)|sequence                             143   6e-35
3S66:1:A|pdbid|entity|chain(s)|sequence                               143   6e-35
3S65:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
3S48:2:C,D|pdbid|entity|chain(s)|sequence                             143   6e-35
3R5I:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
3QJE:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
3QJC:1:A|pdbid|entity|chain(s)|sequence                               143   6e-35
3P5Q:1:A|pdbid|entity|chain(s)|sequence                               143   6e-35
3OVU:3:C|pdbid|entity|chain(s)|sequence                               143   6e-35
3OO5:1:A|pdbid|entity|chain(s)|sequence                               143   6e-35
3OO4:1:A|pdbid|entity|chain(s)|sequence                               143   6e-35
3ONZ:1:A|pdbid|entity|chain(s)|sequence                               143   6e-35
3ODQ:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
3NL7:1:A|pdbid|entity|chain(s)|sequence                               143   6e-35
3KMF:1:A,E|pdbid|entity|chain(s)|sequence                             143   6e-35
3IC2:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
3IC0:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
3HXN:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
3HHB:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
3DUT:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
3D7O:1:A|pdbid|entity|chain(s)|sequence                               143   6e-35
3D17:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
3B75:1:A,C,E,G,S|pdbid|entity|chain(s)|sequence                       143   6e-35
2YRS:1:A,C,I,M|pdbid|entity|chain(s)|sequence                         143   6e-35
2W6V:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
2M6Z:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
2HHE:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
2HHD:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
2HHB:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
2HCO:1:A|pdbid|entity|chain(s)|sequence                               143   6e-35
2HBS:1:A,C,E,G|pdbid|entity|chain(s)|sequence                         143   6e-35
2HBF:1:A|pdbid|entity|chain(s)|sequence                               143   6e-35
2HBE:1:A|pdbid|entity|chain(s)|sequence                               143   6e-35
2HBD:1:A|pdbid|entity|chain(s)|sequence                               143   6e-35
2HBC:1:A|pdbid|entity|chain(s)|sequence                               143   6e-35
2H35:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
2DXM:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
2DN3:1:A|pdbid|entity|chain(s)|sequence                               143   6e-35
2DN2:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
2DN1:1:A|pdbid|entity|chain(s)|sequence                               143   6e-35
2D60:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
2D5Z:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1YZI:1:A|pdbid|entity|chain(s)|sequence                               143   6e-35
1YVT:1:A|pdbid|entity|chain(s)|sequence                               143   6e-35
1YVQ:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1YIH:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1YIE:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1YHR:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1YHE:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1YH9:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1YGF:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1YGD:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1YG5:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1YFF:1:A,C,E,G|pdbid|entity|chain(s)|sequence                         143   6e-35
1YEV:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1YEU:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1YEQ:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1YEO:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1YEN:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1YE2:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1YE1:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1YE0:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1Y85:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1Y83:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1Y7Z:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1Y7G:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1Y7D:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1Y7C:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1Y5K:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1Y5J:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1Y5F:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1Y4V:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1Y4R:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1Y4Q:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1Y4P:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1Y4G:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1Y4F:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1Y4B:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1Y46:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1Y45:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1Y35:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1Y31:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1Y2Z:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1Y22:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1Y0W:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1Y0T:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1XZ2:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1XXT:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1UIW:1:A,C,E,G|pdbid|entity|chain(s)|sequence                         143   6e-35
1THB:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1SI4:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1SHR:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1SDL:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1SDK:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1RQA:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1RQ4:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1RQ3:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1RPS:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1QXE:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1QXD:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1QSI:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1QSH:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1O1P:1:A|pdbid|entity|chain(s)|sequence                               143   6e-35
1NQP:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1NIH:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1NEJ:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1MKO:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1M9P:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1LJW:1:A|pdbid|entity|chain(s)|sequence                               143   6e-35
1LFZ:1:A|pdbid|entity|chain(s)|sequence                               143   6e-35
1LFY:1:A|pdbid|entity|chain(s)|sequence                               143   6e-35
1LFV:1:A|pdbid|entity|chain(s)|sequence                               143   6e-35
1LFT:1:A|pdbid|entity|chain(s)|sequence                               143   6e-35
1LFQ:1:A|pdbid|entity|chain(s)|sequence                               143   6e-35
1LFL:1:A,C,P,R|pdbid|entity|chain(s)|sequence                         143   6e-35
1KD2:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1K1K:1:A|pdbid|entity|chain(s)|sequence                               143   6e-35
1K0Y:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1JY7:1:A,C,P,R,U,W|pdbid|entity|chain(s)|sequence                     143   6e-35
1J41:1:A,C,E,G|pdbid|entity|chain(s)|sequence                         143   6e-35
1J40:1:A,C,E,G|pdbid|entity|chain(s)|sequence                         143   6e-35
1J3Z:1:A,C,E,G|pdbid|entity|chain(s)|sequence                         143   6e-35
1J3Y:1:A,C,E,G|pdbid|entity|chain(s)|sequence                         143   6e-35
1IRD:1:A|pdbid|entity|chain(s)|sequence                               143   6e-35
1HHO:1:A|pdbid|entity|chain(s)|sequence                               143   6e-35
1HGC:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1HGB:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1HGA:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1HDB:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1HCO:1:A|pdbid|entity|chain(s)|sequence                               143   6e-35
1HBS:1:A,C,E,G|pdbid|entity|chain(s)|sequence                         143   6e-35
1HBB:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1HBA:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1HAC:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1HAB:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1GZX:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1GBV:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1GBU:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1G9V:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1FN3:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1FDH:1:A,B|pdbid|entity|chain(s)|sequence                             143   6e-35
1DXV:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1DXU:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1DXT:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1DKE:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1COH:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1CMY:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1CLS:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1C7C:1:A|pdbid|entity|chain(s)|sequence                               143   6e-35
1BZ0:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1BUW:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1BIJ:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1BBB:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1B86:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1ABY:1:A|pdbid|entity|chain(s)|sequence                               143   6e-35
1ABW:1:A|pdbid|entity|chain(s)|sequence                               143   6e-35
1A9W:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1A3N:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1A0Z:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1A0U:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1A01:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1A00:1:A,C|pdbid|entity|chain(s)|sequence                             143   6e-35
1C7D:1:A|pdbid|entity|chain(s)|sequence                               143   7e-35
1AJ9:1:A|pdbid|entity|chain(s)|sequence                               142   9e-35
4MQI:1:A|pdbid|entity|chain(s)|sequence                               142   9e-35
3IA3:2:B,D|pdbid|entity|chain(s)|sequence                             142   9e-35
1Y0D:1:A,C|pdbid|entity|chain(s)|sequence                             142   9e-35
1R1Y:1:A,C|pdbid|entity|chain(s)|sequence                             142   1e-34
1R1X:1:A|pdbid|entity|chain(s)|sequence                               142   1e-34
1BAB:1:A,C|pdbid|entity|chain(s)|sequence                             142   1e-34
1YDZ:1:A,C|pdbid|entity|chain(s)|sequence                             142   1e-34
1Y0C:1:A,C|pdbid|entity|chain(s)|sequence                             142   1e-34
4MQC:1:A|pdbid|entity|chain(s)|sequence                               142   1e-34
1O1K:1:A,C|pdbid|entity|chain(s)|sequence                             142   1e-34
1J7W:1:A,C|pdbid|entity|chain(s)|sequence                             142   1e-34
1C7B:1:A,C|pdbid|entity|chain(s)|sequence                             142   1e-34
1BZZ:1:A,C|pdbid|entity|chain(s)|sequence                             142   1e-34
1XZU:1:A,C|pdbid|entity|chain(s)|sequence                             142   2e-34
1XZV:1:A,C|pdbid|entity|chain(s)|sequence                             141   2e-34
1O1O:1:A,C|pdbid|entity|chain(s)|sequence                             141   2e-34
4MQH:1:A|pdbid|entity|chain(s)|sequence                               141   2e-34
1Y0A:1:A,C|pdbid|entity|chain(s)|sequence                             141   2e-34
1Y09:1:A,C|pdbid|entity|chain(s)|sequence                             141   2e-34
1O1N:1:A|pdbid|entity|chain(s)|sequence                               141   3e-34
1XZ5:1:A,C|pdbid|entity|chain(s)|sequence                             141   3e-34
1Y8W:1:A,C|pdbid|entity|chain(s)|sequence                             140   3e-34
1XZ7:1:A,C|pdbid|entity|chain(s)|sequence                             140   3e-34
3NMM:1:A,C|pdbid|entity|chain(s)|sequence                             140   3e-34
3QJD:1:A,C|pdbid|entity|chain(s)|sequence                             140   4e-34
3QJB:1:A|pdbid|entity|chain(s)|sequence                               140   4e-34
1A3O:1:A,C|pdbid|entity|chain(s)|sequence                             140   4e-34
1O1J:1:A|pdbid|entity|chain(s)|sequence                               140   5e-34
1GLI:1:A,C|pdbid|entity|chain(s)|sequence                             140   5e-34
1XY0:1:A,C|pdbid|entity|chain(s)|sequence                             140   6e-34
1O1M:1:A|pdbid|entity|chain(s)|sequence                               139   6e-34
1O1L:1:A|pdbid|entity|chain(s)|sequence                               139   7e-34
2W72:1:A|pdbid|entity|chain(s)|sequence                               139   8e-34
1O1I:1:A|pdbid|entity|chain(s)|sequence                               139   1e-33
2W72:3:C|pdbid|entity|chain(s)|sequence                               138   2e-33
1QI8:1:A,C|pdbid|entity|chain(s)|sequence                             138   2e-33
1J7Y:1:A,C|pdbid|entity|chain(s)|sequence                             138   2e-33
1J7S:1:A,C|pdbid|entity|chain(s)|sequence                             138   2e-33
1XZ4:1:A,C|pdbid|entity|chain(s)|sequence                             138   2e-33
1XYE:1:A,C|pdbid|entity|chain(s)|sequence                             138   2e-33
2ZLX:1:A,C|pdbid|entity|chain(s)|sequence                             129   1e-30
2ZLW:1:A,C|pdbid|entity|chain(s)|sequence                             129   1e-30
2ZLV:1:A|pdbid|entity|chain(s)|sequence                               129   1e-30
2ZLU:1:A|pdbid|entity|chain(s)|sequence                               129   1e-30
2ZLT:1:A|pdbid|entity|chain(s)|sequence                               129   1e-30
2MHB:1:A|pdbid|entity|chain(s)|sequence                               129   1e-30
2DHB:1:A|pdbid|entity|chain(s)|sequence                               129   1e-30
2D5X:1:A|pdbid|entity|chain(s)|sequence                               129   1e-30
1Y8K:1:A,C|pdbid|entity|chain(s)|sequence                             129   1e-30
1Y8I:1:A,C|pdbid|entity|chain(s)|sequence                             129   1e-30
1Y8H:1:A,C|pdbid|entity|chain(s)|sequence                             129   1e-30
1NS9:1:A|pdbid|entity|chain(s)|sequence                               129   1e-30
1NS6:1:A|pdbid|entity|chain(s)|sequence                               129   1e-30
1IWH:1:A|pdbid|entity|chain(s)|sequence                               129   1e-30
1G0B:1:A|pdbid|entity|chain(s)|sequence                               129   1e-30
1IBE:1:A|pdbid|entity|chain(s)|sequence                               127   3e-30
3GYS:1:A,C,E,G|pdbid|entity|chain(s)|sequence                         127   5e-30
3GQR:1:A,C,E,G|pdbid|entity|chain(s)|sequence                         127   5e-30
3GQP:1:A,C|pdbid|entity|chain(s)|sequence                             127   5e-30
3D4X:1:A,C|pdbid|entity|chain(s)|sequence                             127   5e-30
1S0H:1:A|pdbid|entity|chain(s)|sequence                               126   9e-30
3D1A:1:A,C|pdbid|entity|chain(s)|sequence                             124   3e-29
3EU1:1:A,C|pdbid|entity|chain(s)|sequence                             124   3e-29
2RI4:1:A,C,I,K|pdbid|entity|chain(s)|sequence                         124   3e-29
2QU0:1:A,C|pdbid|entity|chain(s)|sequence                             124   3e-29
3CY5:1:A,C|pdbid|entity|chain(s)|sequence                             124   3e-29
3FH9:1:A|pdbid|entity|chain(s)|sequence                               124   4e-29
3PIA:1:A,C|pdbid|entity|chain(s)|sequence                             123   6e-29
3PI9:1:A,C|pdbid|entity|chain(s)|sequence                             123   6e-29
3PI8:1:A,C|pdbid|entity|chain(s)|sequence                             123   6e-29
3CIU:1:A,C|pdbid|entity|chain(s)|sequence                             123   6e-29
2QSS:1:A,C|pdbid|entity|chain(s)|sequence                             123   6e-29
2QSP:1:A,C|pdbid|entity|chain(s)|sequence                             123   6e-29
1HDA:1:A,C|pdbid|entity|chain(s)|sequence                             123   6e-29
1G0A:1:A,C|pdbid|entity|chain(s)|sequence                             123   6e-29
1G09:1:A,C|pdbid|entity|chain(s)|sequence                             123   6e-29
1G08:1:A,C|pdbid|entity|chain(s)|sequence                             123   6e-29
1FSX:1:A,C|pdbid|entity|chain(s)|sequence                             123   6e-29
2RAO:1:A,C|pdbid|entity|chain(s)|sequence                             122   9e-29
3LQD:1:A,C|pdbid|entity|chain(s)|sequence                             122   1e-28
2B7H:1:A,C|pdbid|entity|chain(s)|sequence                             121   2e-28
1FHJ:1:A,C|pdbid|entity|chain(s)|sequence                             121   2e-28
3VRG:1:A|pdbid|entity|chain(s)|sequence                               121   3e-28
3VRF:1:A|pdbid|entity|chain(s)|sequence                               121   3e-28
3VRE:1:A,C|pdbid|entity|chain(s)|sequence                             121   3e-28
3PEL:1:A|pdbid|entity|chain(s)|sequence                               120   3e-28
3GOU:1:A,C|pdbid|entity|chain(s)|sequence                             120   3e-28
2QLS:1:A,C|pdbid|entity|chain(s)|sequence                             120   3e-28
3HRW:1:A,C|pdbid|entity|chain(s)|sequence                             119   1e-27
3GDJ:1:A,C|pdbid|entity|chain(s)|sequence                             118   2e-27
4F4O:1:A,D,G,J|pdbid|entity|chain(s)|sequence                         117   4e-27
2PGH:1:A,C|pdbid|entity|chain(s)|sequence                             117   4e-27
1QPW:1:A,C|pdbid|entity|chain(s)|sequence                             117   4e-27
4H2L:1:A|pdbid|entity|chain(s)|sequence                               115   1e-26
1HDS:1:A,C|pdbid|entity|chain(s)|sequence                             111   2e-25
3EOK:1:A|pdbid|entity|chain(s)|sequence                               108   2e-24
3FS4:1:A,C|pdbid|entity|chain(s)|sequence                             107   4e-24
3A59:1:A,C,E,G|pdbid|entity|chain(s)|sequence                         107   4e-24
3DHR:1:A,C,E,G|pdbid|entity|chain(s)|sequence                         107   5e-24
1FAW:1:A,C|pdbid|entity|chain(s)|sequence                             107   6e-24
3MJU:1:A|pdbid|entity|chain(s)|sequence                               106   6e-24
2R80:1:A,C|pdbid|entity|chain(s)|sequence                             106   6e-24
3MJP:1:A,C|pdbid|entity|chain(s)|sequence                             104   4e-23
3WTG:1:A,C|pdbid|entity|chain(s)|sequence                             104   4e-23
2QMB:1:A,C|pdbid|entity|chain(s)|sequence                             103   5e-23
1C40:1:A|pdbid|entity|chain(s)|sequence                               103   5e-23
3K8B:1:A,C|pdbid|entity|chain(s)|sequence                             103   6e-23
1HV4:1:A,C,E,G|pdbid|entity|chain(s)|sequence                         103   6e-23
1A4F:1:A|pdbid|entity|chain(s)|sequence                               103   6e-23
3HYU:1:A|pdbid|entity|chain(s)|sequence                               102   2e-22
3A0G:1:A|pdbid|entity|chain(s)|sequence                               102   2e-22
3AT6:1:A|pdbid|entity|chain(s)|sequence                               101   3e-22
3AT5:1:A|pdbid|entity|chain(s)|sequence                               101   3e-22
2ZFB:1:A|pdbid|entity|chain(s)|sequence                               100   4e-22
3WR1:1:A|pdbid|entity|chain(s)|sequence                                98   2e-21
3HF4:1:A,E|pdbid|entity|chain(s)|sequence                              90   9e-19
3DHT:1:A|pdbid|entity|chain(s)|sequence                                90   9e-19
1HBR:1:A,C|pdbid|entity|chain(s)|sequence                              89   1e-18
2Z6N:1:A|pdbid|entity|chain(s)|sequence                                86   1e-17
1WMU:1:A|pdbid|entity|chain(s)|sequence                                86   1e-17
1V75:1:A|pdbid|entity|chain(s)|sequence                                86   1e-17
3W4U:1:A,C,E|pdbid|entity|chain(s)|sequence                            77   6e-15
1JEB:1:A,C|pdbid|entity|chain(s)|sequence                              77   7e-15
3BCQ:1:A,C|pdbid|entity|chain(s)|sequence                              71   4e-13
1V4X:1:A,C|pdbid|entity|chain(s)|sequence                              69   1e-12
1V4W:1:A,C|pdbid|entity|chain(s)|sequence                              69   1e-12
1V4U:1:A,C|pdbid|entity|chain(s)|sequence                              69   1e-12
1XQ5:1:A,C|pdbid|entity|chain(s)|sequence                              69   1e-12
3BJ3:1:A,C|pdbid|entity|chain(s)|sequence                              69   2e-12
3BJ2:1:A,C|pdbid|entity|chain(s)|sequence                              69   2e-12
3BJ1:1:A,C|pdbid|entity|chain(s)|sequence                              69   2e-12
4IRO:1:A,C|pdbid|entity|chain(s)|sequence                              67   5e-12
4G51:1:A,C|pdbid|entity|chain(s)|sequence                              67   5e-12
3GQG:1:A,C|pdbid|entity|chain(s)|sequence                              67   5e-12
3GKV:1:A|pdbid|entity|chain(s)|sequence                                67   5e-12
2PEG:1:A|pdbid|entity|chain(s)|sequence                                67   5e-12
2H8F:1:A,C|pdbid|entity|chain(s)|sequence                              67   5e-12
2H8D:1:A,C|pdbid|entity|chain(s)|sequence                              67   5e-12
1S5Y:1:A,C|pdbid|entity|chain(s)|sequence                              67   5e-12
1S5X:1:A|pdbid|entity|chain(s)|sequence                                67   5e-12
1PBX:1:A|pdbid|entity|chain(s)|sequence                                67   5e-12
1HBH:1:A,C|pdbid|entity|chain(s)|sequence                              67   5e-12
3NG6:1:A,C|pdbid|entity|chain(s)|sequence                              65   2e-11
3NFE:1:A,C|pdbid|entity|chain(s)|sequence                              65   2e-11
3D1K:1:A|pdbid|entity|chain(s)|sequence                                65   2e-11
2AA1:1:A,C|pdbid|entity|chain(s)|sequence                              65   2e-11
1T1N:1:A|pdbid|entity|chain(s)|sequence                                65   2e-11
1LA6:1:A|pdbid|entity|chain(s)|sequence                                65   2e-11
3BOM:1:A,C|pdbid|entity|chain(s)|sequence                              64   6e-11
2R1H:1:A,C|pdbid|entity|chain(s)|sequence                              64   6e-11
4ESA:1:A,C|pdbid|entity|chain(s)|sequence                              63   1e-10
1OUU:1:A,C|pdbid|entity|chain(s)|sequence                              62   2e-10
1OUT:1:A|pdbid|entity|chain(s)|sequence                                62   2e-10
1SPG:1:A|pdbid|entity|chain(s)|sequence                                61   4e-10
1SI4:2:B,D|pdbid|entity|chain(s)|sequence                              54   5e-08
1SHR:2:B,D|pdbid|entity|chain(s)|sequence                              54   5e-08
1YE2:2:B,D|pdbid|entity|chain(s)|sequence                              53   1e-07
1Y35:2:B,D|pdbid|entity|chain(s)|sequence                              53   1e-07
1CH4:1:A,B,C,D|pdbid|entity|chain(s)|sequence                          52   1e-07
2HHE:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1HBA:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1YGD:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1YEV:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1Y4P:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1RQA:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1YIE:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1YEO:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1Y4F:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1A01:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1Y2Z:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
3W4U:2:B,D,F|pdbid|entity|chain(s)|sequence                            52   2e-07
2HBS:2:B,D,F,H|pdbid|entity|chain(s)|sequence                          52   2e-07
1Y85:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1NEJ:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1HBS:2:B,D,F,H|pdbid|entity|chain(s)|sequence                          52   2e-07
1YEQ:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1Y46:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1A00:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1YEU:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1Y4G:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
2QU0:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
2YRS:2:B,D,K,O|pdbid|entity|chain(s)|sequence                          52   2e-07
1Y0W:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1Y0T:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1O1N:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1O1L:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1J7S:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1GLI:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1DXU:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1DXT:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1A0Z:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1A0U:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1Y7D:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1YGF:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1Y5J:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1CMY:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
4NI0:2:B|pdbid|entity|chain(s)|sequence                                52   2e-07
4N7P:2:B,D,F,H,J,L|pdbid|entity|chain(s)|sequence                      52   2e-07
4N7O:2:B,D,F,H,J,L|pdbid|entity|chain(s)|sequence                      52   2e-07
4N7N:2:B,D,F,H,J,L|pdbid|entity|chain(s)|sequence                      52   2e-07
4MQH:2:B|pdbid|entity|chain(s)|sequence                                52   2e-07
4MQC:2:B|pdbid|entity|chain(s)|sequence                                52   2e-07
4M4B:2:B|pdbid|entity|chain(s)|sequence                                52   2e-07
4M4A:2:B|pdbid|entity|chain(s)|sequence                                52   2e-07
4L7Y:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
4IJ2:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
4HHB:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
4FC3:2:B|pdbid|entity|chain(s)|sequence                                52   2e-07
3WCP:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
3SZK:2:B,E|pdbid|entity|chain(s)|sequence                              52   2e-07
3R5I:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
3QJD:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
3QJB:2:B|pdbid|entity|chain(s)|sequence                                52   2e-07
3P5Q:2:B|pdbid|entity|chain(s)|sequence                                52   2e-07
3OO5:2:B|pdbid|entity|chain(s)|sequence                                52   2e-07
3OO4:2:B|pdbid|entity|chain(s)|sequence                                52   2e-07
3ONZ:2:B|pdbid|entity|chain(s)|sequence                                52   2e-07
3ODQ:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
3NMM:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
3KMF:2:C,G|pdbid|entity|chain(s)|sequence                              52   2e-07
3IC2:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
3IC0:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
3HXN:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
3HHB:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
3D7O:2:B|pdbid|entity|chain(s)|sequence                                52   2e-07
3D17:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
3B75:2:B,D,F,H,T|pdbid|entity|chain(s)|sequence                        52   2e-07
2W6V:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
2M6Z:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
2HHD:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
2HHB:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
2HCO:2:B|pdbid|entity|chain(s)|sequence                                52   2e-07
2HBF:2:B|pdbid|entity|chain(s)|sequence                                52   2e-07
2HBE:2:B|pdbid|entity|chain(s)|sequence                                52   2e-07
2HBD:2:B|pdbid|entity|chain(s)|sequence                                52   2e-07
2HBC:2:B|pdbid|entity|chain(s)|sequence                                52   2e-07
2H35:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
2DXM:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
2DN3:2:B|pdbid|entity|chain(s)|sequence                                52   2e-07
2DN2:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
2DN1:2:B|pdbid|entity|chain(s)|sequence                                52   2e-07
2D60:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
2D5Z:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1YZI:2:B|pdbid|entity|chain(s)|sequence                                52   2e-07
1YHR:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1YHE:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1YH9:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1YDZ:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1Y8W:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1Y0D:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1Y0C:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1Y0A:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1Y09:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1XZV:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1XZU:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1XZ7:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1XZ5:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1XZ4:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1XZ2:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1XYE:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1XY0:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1XXT:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1VWT:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1UIW:2:B,D,F,H|pdbid|entity|chain(s)|sequence                          52   2e-07
1THB:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1SDL:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1SDK:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1RVW:2:B|pdbid|entity|chain(s)|sequence                                52   2e-07
1RQ4:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1RQ3:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1RPS:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1R1Y:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1R1X:2:B|pdbid|entity|chain(s)|sequence                                52   2e-07
1QXE:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1QXD:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1QSI:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1QSH:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1O1J:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1O1I:2:B|pdbid|entity|chain(s)|sequence                                52   2e-07
1NIH:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1MKO:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1LJW:2:B|pdbid|entity|chain(s)|sequence                                52   2e-07
1LFZ:2:B|pdbid|entity|chain(s)|sequence                                52   2e-07
1LFY:2:B|pdbid|entity|chain(s)|sequence                                52   2e-07
1LFV:2:B|pdbid|entity|chain(s)|sequence                                52   2e-07
1LFT:2:B|pdbid|entity|chain(s)|sequence                                52   2e-07
1LFQ:2:B|pdbid|entity|chain(s)|sequence                                52   2e-07
1LFL:2:B,D,Q,S|pdbid|entity|chain(s)|sequence                          52   2e-07
1KD2:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1K0Y:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1JY7:2:B,D,Q,S,V,X|pdbid|entity|chain(s)|sequence                      52   2e-07
1J41:2:B,D,F,H|pdbid|entity|chain(s)|sequence                          52   2e-07
1J40:2:B,D,F,H|pdbid|entity|chain(s)|sequence                          52   2e-07
1J3Z:2:B,D,F,H|pdbid|entity|chain(s)|sequence                          52   2e-07
1J3Y:2:B,D,F,H|pdbid|entity|chain(s)|sequence                          52   2e-07
1IRD:2:B|pdbid|entity|chain(s)|sequence                                52   2e-07
1HHO:2:B|pdbid|entity|chain(s)|sequence                                52   2e-07
1HGC:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1HGB:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1HGA:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1HCO:2:B|pdbid|entity|chain(s)|sequence                                52   2e-07
1HBB:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1HAC:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1HAB:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1GZX:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1G9V:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1FN3:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1DKE:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1COH:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1CLS:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1CBM:1:A,B,C,D|pdbid|entity|chain(s)|sequence                          52   2e-07
1CBL:1:A,B,C,D|pdbid|entity|chain(s)|sequence                          52   2e-07
1BZZ:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1BZ1:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1BZ0:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1BUW:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1BIJ:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1BBB:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1BAB:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1B86:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1AJ9:2:B|pdbid|entity|chain(s)|sequence                                52   2e-07
1A3O:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1A3N:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
3S66:2:B|pdbid|entity|chain(s)|sequence                                52   2e-07
3S65:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1YFF:2:B,D,F,H|pdbid|entity|chain(s)|sequence                          52   2e-07
1M9P:2:B,D|pdbid|entity|chain(s)|sequence                              52   2e-07
1K1K:2:B|pdbid|entity|chain(s)|sequence                                52   2e-07
1C7D:2:B,D|pdbid|entity|chain(s)|sequence                              52   3e-07
1C7C:2:B,D|pdbid|entity|chain(s)|sequence                              52   3e-07
1C7B:2:B,D|pdbid|entity|chain(s)|sequence                              52   3e-07
1ABY:2:B,D|pdbid|entity|chain(s)|sequence                              52   3e-07
1ABW:2:B,D|pdbid|entity|chain(s)|sequence                              52   3e-07
1Y83:2:B,D|pdbid|entity|chain(s)|sequence                              52   3e-07
1YIH:2:B,D|pdbid|entity|chain(s)|sequence                              52   3e-07
1Y7C:2:B,D|pdbid|entity|chain(s)|sequence                              52   3e-07
1Y5K:2:B,D|pdbid|entity|chain(s)|sequence                              52   3e-07
1YG5:2:B,D|pdbid|entity|chain(s)|sequence                              51   3e-07
1Y4B:2:B,D|pdbid|entity|chain(s)|sequence                              51   3e-07
1Y7Z:2:B,D|pdbid|entity|chain(s)|sequence                              51   3e-07
1Y7G:2:B,D|pdbid|entity|chain(s)|sequence                              51   3e-07
1DXV:2:B,D|pdbid|entity|chain(s)|sequence                              51   3e-07
1Y5F:2:B,D|pdbid|entity|chain(s)|sequence                              51   3e-07
3EU1:2:B,D|pdbid|entity|chain(s)|sequence                              51   4e-07
3D1A:2:B,D|pdbid|entity|chain(s)|sequence                              51   4e-07
2RI4:2:B,D,J,L|pdbid|entity|chain(s)|sequence                          51   4e-07
6HBW:2:B,D|pdbid|entity|chain(s)|sequence                              51   4e-07
1GBV:2:B,D|pdbid|entity|chain(s)|sequence                              51   4e-07
1Y4V:2:B,D|pdbid|entity|chain(s)|sequence                              51   4e-07
1O1P:2:B,D|pdbid|entity|chain(s)|sequence                              51   5e-07
1O1O:2:B,D|pdbid|entity|chain(s)|sequence                              50   5e-07
3CY5:2:B,D|pdbid|entity|chain(s)|sequence                              50   5e-07
4MQI:2:B|pdbid|entity|chain(s)|sequence                                50   5e-07
4MQG:2:B|pdbid|entity|chain(s)|sequence                                50   5e-07
1GBU:2:B,D|pdbid|entity|chain(s)|sequence                              50   6e-07
1YE0:2:B,D|pdbid|entity|chain(s)|sequence                              50   6e-07
1Y22:2:B,D|pdbid|entity|chain(s)|sequence                              50   6e-07
1HDS:2:B,D|pdbid|entity|chain(s)|sequence                              50   6e-07
1HDB:2:B,D|pdbid|entity|chain(s)|sequence                              50   7e-07
3DUT:2:B,D|pdbid|entity|chain(s)|sequence                              50   7e-07
1YVT:2:B|pdbid|entity|chain(s)|sequence                                50   7e-07
1YVQ:2:B,D|pdbid|entity|chain(s)|sequence                              50   7e-07
1NQP:2:B,D|pdbid|entity|chain(s)|sequence                              50   7e-07
1JEB:2:B,D|pdbid|entity|chain(s)|sequence                              50   1e-06
1YE1:2:B,D|pdbid|entity|chain(s)|sequence                              49   1e-06
1Y31:2:B,D|pdbid|entity|chain(s)|sequence                              49   1e-06
1O1M:2:B,D|pdbid|entity|chain(s)|sequence                              49   1e-06
1O1K:2:B,D|pdbid|entity|chain(s)|sequence                              49   1e-06
1GCW:1:A,C|pdbid|entity|chain(s)|sequence                              49   2e-06
1GCV:1:A,C|pdbid|entity|chain(s)|sequence                              49   2e-06
2RAO:2:B,D|pdbid|entity|chain(s)|sequence                              49   2e-06
1YEN:2:B,D|pdbid|entity|chain(s)|sequence                              49   2e-06
1Y45:2:B,D|pdbid|entity|chain(s)|sequence                              49   2e-06
3HRW:2:B,D|pdbid|entity|chain(s)|sequence                              49   2e-06
3NL7:2:B|pdbid|entity|chain(s)|sequence                                48   2e-06
3PIA:2:B,D|pdbid|entity|chain(s)|sequence                              48   3e-06
3PI9:2:B,D|pdbid|entity|chain(s)|sequence                              48   3e-06
3PI8:2:B,D|pdbid|entity|chain(s)|sequence                              48   3e-06
3CIU:2:B,D|pdbid|entity|chain(s)|sequence                              48   3e-06
2QSS:2:B,D|pdbid|entity|chain(s)|sequence                              48   3e-06
2QSP:2:B,D|pdbid|entity|chain(s)|sequence                              48   3e-06
1HDA:2:B,D|pdbid|entity|chain(s)|sequence                              48   3e-06
1G0A:2:B,D|pdbid|entity|chain(s)|sequence                              48   3e-06
1G09:2:B,D|pdbid|entity|chain(s)|sequence                              48   3e-06
1G08:2:B,D|pdbid|entity|chain(s)|sequence                              48   3e-06
1FSX:2:B,D|pdbid|entity|chain(s)|sequence                              48   3e-06
3FH9:2:B|pdbid|entity|chain(s)|sequence                                48   3e-06
1Y4R:2:B,D|pdbid|entity|chain(s)|sequence                              48   3e-06
1Y4Q:2:B,D|pdbid|entity|chain(s)|sequence                              48   3e-06
3QJE:2:B,D|pdbid|entity|chain(s)|sequence                              48   3e-06
3QJC:2:B|pdbid|entity|chain(s)|sequence                                48   3e-06
3HF4:2:B,F|pdbid|entity|chain(s)|sequence                              48   3e-06
3DHT:2:B|pdbid|entity|chain(s)|sequence                                48   3e-06
3VRG:2:B|pdbid|entity|chain(s)|sequence                                47   4e-06
3VRF:2:B|pdbid|entity|chain(s)|sequence                                47   4e-06
3VRE:2:B,D|pdbid|entity|chain(s)|sequence                              47   4e-06
3LQD:2:B,D|pdbid|entity|chain(s)|sequence                              47   4e-06
2W72:2:B,D|pdbid|entity|chain(s)|sequence                              47   4e-06
1QI8:2:B,D|pdbid|entity|chain(s)|sequence                              47   4e-06
1J7Y:2:B,D|pdbid|entity|chain(s)|sequence                              47   4e-06
1J7W:2:B,D|pdbid|entity|chain(s)|sequence                              47   4e-06
1CG8:1:A|pdbid|entity|chain(s)|sequence                                47   5e-06
1CG5:1:A|pdbid|entity|chain(s)|sequence                                47   5e-06
4H2L:2:B|pdbid|entity|chain(s)|sequence                                47   6e-06
4MQJ:2:B,D,F,H|pdbid|entity|chain(s)|sequence                          47   7e-06
1FDH:2:G,H|pdbid|entity|chain(s)|sequence                              47   8e-06
4F4O:2:B,E,H,K|pdbid|entity|chain(s)|sequence                          47   8e-06
2PGH:2:B,D|pdbid|entity|chain(s)|sequence                              47   9e-06
1QPW:2:B,D|pdbid|entity|chain(s)|sequence                              47   9e-06
1I3E:1:A,B|pdbid|entity|chain(s)|sequence                              47   9e-06
1I3D:1:A,B|pdbid|entity|chain(s)|sequence                              47   9e-06
3GYS:2:B,D,F,H|pdbid|entity|chain(s)|sequence                          46   2e-05
3GQR:2:B,D,F,H|pdbid|entity|chain(s)|sequence                          46   2e-05
3GQP:2:B,D|pdbid|entity|chain(s)|sequence                              46   2e-05
3D4X:2:B,D|pdbid|entity|chain(s)|sequence                              46   2e-05
4MQK:2:B,D,F,H|pdbid|entity|chain(s)|sequence                          45   2e-05
3HYU:2:B|pdbid|entity|chain(s)|sequence                                45   2e-05
3A0G:2:B|pdbid|entity|chain(s)|sequence                                45   2e-05
3MKB:1:A,C|pdbid|entity|chain(s)|sequence                              45   3e-05
1SPG:2:B|pdbid|entity|chain(s)|sequence                                45   3e-05
1UC3:1:A,B,C,D,E,F,G,H,I,J,K,L|pdbid|entity|chain(s)|sequence          44   4e-05
1F5P:1:A,B,C,D,E,F|pdbid|entity|chain(s)|sequence                      44   7e-05
1F5O:1:A,B,C,D,E,F|pdbid|entity|chain(s)|sequence                      44   7e-05
3PEL:2:B|pdbid|entity|chain(s)|sequence                                44   7e-05
3GOU:2:B,D|pdbid|entity|chain(s)|sequence                              44   7e-05
2QLS:2:B,D|pdbid|entity|chain(s)|sequence                              44   7e-05
1FHJ:2:B,D|pdbid|entity|chain(s)|sequence                              44   7e-05
2DHB:2:B|pdbid|entity|chain(s)|sequence                                43   1e-04
3MJU:2:B|pdbid|entity|chain(s)|sequence                                43   1e-04
3DHR:2:B,D,F,H|pdbid|entity|chain(s)|sequence                          43   1e-04
2R80:2:B,D|pdbid|entity|chain(s)|sequence                              43   1e-04
3LHB:1:A,B,C,D,E,F,G,H,I,J,K,L|pdbid|entity|chain(s)|sequence          43   1e-04
2LHB:1:A|pdbid|entity|chain(s)|sequence                                43   1e-04
2ZLX:2:B,D|pdbid|entity|chain(s)|sequence                              42   2e-04
2ZLW:2:B,D|pdbid|entity|chain(s)|sequence                              42   2e-04
2ZLV:2:B|pdbid|entity|chain(s)|sequence                                42   2e-04
2ZLU:2:B|pdbid|entity|chain(s)|sequence                                42   2e-04
2ZLT:2:B|pdbid|entity|chain(s)|sequence                                42   2e-04
2MHB:2:B|pdbid|entity|chain(s)|sequence                                42   2e-04
2D5X:2:B|pdbid|entity|chain(s)|sequence                                42   2e-04
1Y8K:2:B,D|pdbid|entity|chain(s)|sequence                              42   2e-04
1Y8I:2:B,D|pdbid|entity|chain(s)|sequence                              42   2e-04
1Y8H:2:B,D|pdbid|entity|chain(s)|sequence                              42   2e-04
1S0H:2:B|pdbid|entity|chain(s)|sequence                                42   2e-04
1NS9:2:B|pdbid|entity|chain(s)|sequence                                42   2e-04
1NS6:2:B|pdbid|entity|chain(s)|sequence                                42   2e-04
1IWH:2:B|pdbid|entity|chain(s)|sequence                                42   2e-04
1IBE:2:B|pdbid|entity|chain(s)|sequence                                42   2e-04
1G0B:2:B|pdbid|entity|chain(s)|sequence                                42   2e-04
2B7H:2:B,D|pdbid|entity|chain(s)|sequence                              41   3e-04
1UX9:1:A,B|pdbid|entity|chain(s)|sequence                              40   9e-04
1UT0:1:A,B|pdbid|entity|chain(s)|sequence                              40   9e-04
1URY:1:A,B|pdbid|entity|chain(s)|sequence                              40   9e-04
1URV:1:A,B|pdbid|entity|chain(s)|sequence                              40   9e-04
1UMO:1:A,B|pdbid|entity|chain(s)|sequence                              40   9e-04
1OUU:2:B,D|pdbid|entity|chain(s)|sequence                              39   0.002
1OUT:2:B|pdbid|entity|chain(s)|sequence                                39   0.002
3AG0:1:A|pdbid|entity|chain(s)|sequence                                39   0.002
2DC3:1:A,B|pdbid|entity|chain(s)|sequence                              39   0.002
1V5H:1:A|pdbid|entity|chain(s)|sequence                                39   0.002
2Z6N:2:B|pdbid|entity|chain(s)|sequence                                38   0.004
1WMU:2:B|pdbid|entity|chain(s)|sequence                                38   0.004
1V75:2:B|pdbid|entity|chain(s)|sequence                                38   0.004
4B3W:1:A,B|pdbid|entity|chain(s)|sequence                              37   0.005
1A9W:2:E,F|pdbid|entity|chain(s)|sequence                              37   0.005
4HRT:1:A,C,E,G|pdbid|entity|chain(s)|sequence                          35   0.019
4HRR:1:A,C,E,G|pdbid|entity|chain(s)|sequence                          35   0.019
2C0K:1:A,B|pdbid|entity|chain(s)|sequence                              34   0.037
1HLM:1:A|pdbid|entity|chain(s)|sequence                                33   0.092
1MYH:1:A,B|pdbid|entity|chain(s)|sequence                              33   0.12 
1LHT:1:A|pdbid|entity|chain(s)|sequence                                32   0.15 
1LHS:1:A|pdbid|entity|chain(s)|sequence                                32   0.15 
1PMB:1:A,B|pdbid|entity|chain(s)|sequence                              32   0.16 
1MYG:1:A,B|pdbid|entity|chain(s)|sequence                              32   0.16 
1MWD:1:A,B|pdbid|entity|chain(s)|sequence                              32   0.16 
1MWC:1:A,B|pdbid|entity|chain(s)|sequence                              32   0.16 
1MYI:1:A,B|pdbid|entity|chain(s)|sequence                              32   0.16 
3QMA:1:A|pdbid|entity|chain(s)|sequence                                32   0.21 
3QM9:1:A|pdbid|entity|chain(s)|sequence                                32   0.21 
3QM8:1:A|pdbid|entity|chain(s)|sequence                                32   0.21 
3QM7:1:A|pdbid|entity|chain(s)|sequence                                32   0.21 
3QM6:1:A|pdbid|entity|chain(s)|sequence                                32   0.21 
3QM5:1:A|pdbid|entity|chain(s)|sequence                                32   0.21 
3MKB:2:B,D|pdbid|entity|chain(s)|sequence                              32   0.22 
1V4X:2:B,D|pdbid|entity|chain(s)|sequence                              32   0.22 
1V4W:2:B,D|pdbid|entity|chain(s)|sequence                              32   0.22 
1V4U:2:B,D|pdbid|entity|chain(s)|sequence                              32   0.22 
2NX0:1:A|pdbid|entity|chain(s)|sequence                                32   0.23 
2NRM:1:A|pdbid|entity|chain(s)|sequence                                32   0.23 
2NRL:1:A|pdbid|entity|chain(s)|sequence                                32   0.23 
1H1X:1:A|pdbid|entity|chain(s)|sequence                                32   0.24 
3RGK:1:A|pdbid|entity|chain(s)|sequence                                31   0.32 
1MYT:1:A|pdbid|entity|chain(s)|sequence                                31   0.33 
3RJ6:1:A,B|pdbid|entity|chain(s)|sequence                              31   0.36 
1NZ5:1:A|pdbid|entity|chain(s)|sequence                                31   0.38 
1NZ4:1:A|pdbid|entity|chain(s)|sequence                                31   0.38 
1NZ3:1:A|pdbid|entity|chain(s)|sequence                                31   0.38 
1NZ2:1:A|pdbid|entity|chain(s)|sequence                                31   0.38 
1HRM:1:A|pdbid|entity|chain(s)|sequence                                31   0.40 
4DC8:1:A|pdbid|entity|chain(s)|sequence                                31   0.45 
4DC7:1:A|pdbid|entity|chain(s)|sequence                                31   0.45 
3WI8:1:A|pdbid|entity|chain(s)|sequence                                31   0.45 
3VM9:1:A,B|pdbid|entity|chain(s)|sequence                              31   0.45 
3VAU:1:A|pdbid|entity|chain(s)|sequence                                31   0.45 
3V2Z:1:A|pdbid|entity|chain(s)|sequence                                31   0.45 
3V2V:1:A|pdbid|entity|chain(s)|sequence                                31   0.45 
3RJN:1:B|pdbid|entity|chain(s)|sequence                                31   0.45 
3LR9:1:A|pdbid|entity|chain(s)|sequence                                31   0.45 
3LR7:1:A|pdbid|entity|chain(s)|sequence                                31   0.45 
3BA2:1:A|pdbid|entity|chain(s)|sequence                                31   0.45 
2VM0:1:A|pdbid|entity|chain(s)|sequence                                31   0.45 
2VLZ:1:A|pdbid|entity|chain(s)|sequence                                31   0.45 
2VLY:1:A|pdbid|entity|chain(s)|sequence                                31   0.45 
2VLX:1:A|pdbid|entity|chain(s)|sequence                                31   0.45 
2V1K:1:A|pdbid|entity|chain(s)|sequence                                31   0.45 
2V1J:1:A|pdbid|entity|chain(s)|sequence                                31   0.45 
2V1I:1:A|pdbid|entity|chain(s)|sequence                                31   0.45 
2V1H:1:A|pdbid|entity|chain(s)|sequence                                31   0.45 
2V1G:1:A|pdbid|entity|chain(s)|sequence                                31   0.45 
2V1F:1:A|pdbid|entity|chain(s)|sequence                                31   0.45 
2V1E:1:A|pdbid|entity|chain(s)|sequence                                31   0.45 
2O5T:1:X|pdbid|entity|chain(s)|sequence                                31   0.45 
2O5S:1:X|pdbid|entity|chain(s)|sequence                                31   0.45 
2O5Q:1:X|pdbid|entity|chain(s)|sequence                                31   0.45 
2O5O:1:X|pdbid|entity|chain(s)|sequence                                31   0.45 
2O5M:1:X|pdbid|entity|chain(s)|sequence                                31   0.45 
2O5L:1:X|pdbid|entity|chain(s)|sequence                                31   0.45 
2O5B:1:X|pdbid|entity|chain(s)|sequence                                31   0.45 
2O58:1:X|pdbid|entity|chain(s)|sequence                                31   0.45 
2NSS:1:A|pdbid|entity|chain(s)|sequence                                31   0.45 
2NSR:1:A|pdbid|entity|chain(s)|sequence                                31   0.45 
2IN4:1:A|pdbid|entity|chain(s)|sequence                                31   0.45 
2FRK:1:X|pdbid|entity|chain(s)|sequence                                31   0.45 
2FRJ:1:X|pdbid|entity|chain(s)|sequence                                31   0.45 
2FRI:1:X|pdbid|entity|chain(s)|sequence                                31   0.45 
2FRF:1:A|pdbid|entity|chain(s)|sequence                                31   0.45 
1YMC:1:A|pdbid|entity|chain(s)|sequence                                31   0.45 
1YMB:1:A|pdbid|entity|chain(s)|sequence                                31   0.45 
1WLA:1:A|pdbid|entity|chain(s)|sequence                                31   0.45 
1RSE:1:A|pdbid|entity|chain(s)|sequence                                31   0.45 
1NPG:1:A|pdbid|entity|chain(s)|sequence                                31   0.45 
1NPF:1:A|pdbid|entity|chain(s)|sequence                                31   0.45 
1GJN:1:A|pdbid|entity|chain(s)|sequence                                31   0.45 
1DWT:1:A|pdbid|entity|chain(s)|sequence                                31   0.45 
1DWS:1:A|pdbid|entity|chain(s)|sequence                                31   0.45 
1DWR:1:A|pdbid|entity|chain(s)|sequence                                31   0.45 
1AZI:1:A|pdbid|entity|chain(s)|sequence                                31   0.45 
1YCB:1:A,B|pdbid|entity|chain(s)|sequence                              31   0.45 
1YCA:1:A,B|pdbid|entity|chain(s)|sequence                              31   0.45 
1MYJ:1:A,B|pdbid|entity|chain(s)|sequence                              31   0.45 
1CH9:1:A|pdbid|entity|chain(s)|sequence                                31   0.47 
3A2G:1:A|pdbid|entity|chain(s)|sequence                                31   0.48 
1CH7:1:A|pdbid|entity|chain(s)|sequence                                31   0.48 
1CH5:1:A|pdbid|entity|chain(s)|sequence                                31   0.48 
1DTI:1:A|pdbid|entity|chain(s)|sequence                                31   0.49 
1XCH:1:A|pdbid|entity|chain(s)|sequence                                31   0.50 
1IRC:1:A|pdbid|entity|chain(s)|sequence                                31   0.53 
2OHA:1:A|pdbid|entity|chain(s)|sequence                                30   0.55 
1LUE:1:A|pdbid|entity|chain(s)|sequence                                30   0.56 
3ASE:1:A|pdbid|entity|chain(s)|sequence                                30   0.56 
2MGM:1:A|pdbid|entity|chain(s)|sequence                                30   0.56 
2MGL:1:A|pdbid|entity|chain(s)|sequence                                30   0.56 
2MGK:1:A|pdbid|entity|chain(s)|sequence                                30   0.56 
2MBW:1:A|pdbid|entity|chain(s)|sequence                                30   0.56 
2EVP:1:A|pdbid|entity|chain(s)|sequence                                30   0.56 
2EVK:1:A|pdbid|entity|chain(s)|sequence                                30   0.56 
1TES:1:A|pdbid|entity|chain(s)|sequence                                30   0.56 
1JW8:1:A|pdbid|entity|chain(s)|sequence                                30   0.56 
1J52:1:A|pdbid|entity|chain(s)|sequence                                30   0.56 
1DUO:1:A|pdbid|entity|chain(s)|sequence                                30   0.56 
1DTM:1:A|pdbid|entity|chain(s)|sequence                                30   0.56 
1CPW:1:A|pdbid|entity|chain(s)|sequence                                30   0.56 
1CH3:1:A|pdbid|entity|chain(s)|sequence                                30   0.56 
1ABS:1:A|pdbid|entity|chain(s)|sequence                                30   0.56 
112M:1:A|pdbid|entity|chain(s)|sequence                                30   0.56 
111M:1:A|pdbid|entity|chain(s)|sequence                                30   0.56 
110M:1:A|pdbid|entity|chain(s)|sequence                                30   0.56 
109M:1:A|pdbid|entity|chain(s)|sequence                                30   0.56 
1A6N:1:A|pdbid|entity|chain(s)|sequence                                30   0.57 
1A6M:1:A|pdbid|entity|chain(s)|sequence                                30   0.57 
1A6K:1:A|pdbid|entity|chain(s)|sequence                                30   0.57 
3U3E:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
2W6W:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
2JHO:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
2EB9:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
2EB8:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
1UFP:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
1CIO:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
1A6G:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
5MBN:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
4MBN:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
3EDB:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
3EDA:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
3ED9:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
3ECZ:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
3ECX:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
3ECL:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
3E5O:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
3E5I:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
3E55:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
3E4N:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
2ZT4:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
2ZT3:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
2ZT2:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
2ZT1:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
2ZT0:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
2ZSZ:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
2ZSY:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
2ZSX:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
2ZST:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
2ZSS:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
2ZSR:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
2ZSQ:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
2ZSP:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
2ZSO:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
2ZSN:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
2Z6T:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
2Z6S:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
2MYE:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
2MYD:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
2MYC:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
2MYB:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
2MYA:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
2MB5:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
2EKU:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
2EKT:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
2D6C:1:A,B|pdbid|entity|chain(s)|sequence                              30   0.58 
2CMM:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
1YOI:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
1YOH:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
1YOG:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
1WVP:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
1VXH:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
1VXG:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
1VXF:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
1VXE:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
1VXD:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
1VXC:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
1VXB:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
1VXA:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
1U7S:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
1U7R:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
1SWM:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
1SPE:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
1MYF:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
1MBO:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
1MBN:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
1MBI:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
1MBD:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
1MBC:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
1L2K:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
1JPB:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
1JP9:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
1JP8:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
1JP6:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
1IOP:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
1HJT:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
1F6H:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
1EBC:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
1DUK:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
1CQ2:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
1BZR:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
1BZP:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
1BZ6:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
1BVD:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
1BVC:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
1AJH:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
1AJG:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
105M:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
104M:1:A|pdbid|entity|chain(s)|sequence                                30   0.58 
1CP0:1:A|pdbid|entity|chain(s)|sequence                                30   0.59 
2OHB:1:A|pdbid|entity|chain(s)|sequence                                30   0.59 
1CP5:1:A|pdbid|entity|chain(s)|sequence                                30   0.59 
1CO9:1:A|pdbid|entity|chain(s)|sequence                                30   0.59 
1CH2:1:A|pdbid|entity|chain(s)|sequence                                30   0.59 
1CH1:1:A|pdbid|entity|chain(s)|sequence                                30   0.59 
1CO8:1:A|pdbid|entity|chain(s)|sequence                                30   0.66 
1CIK:1:A|pdbid|entity|chain(s)|sequence                                30   0.67 
1MLO:1:A|pdbid|entity|chain(s)|sequence                                30   0.71 
1MLN:1:A|pdbid|entity|chain(s)|sequence                                30   0.71 
1MLM:1:A|pdbid|entity|chain(s)|sequence                                30   0.71 
2OH8:1:A|pdbid|entity|chain(s)|sequence                                30   0.82 
3HEO:1:A|pdbid|entity|chain(s)|sequence                                30   0.86 
3HEN:1:A|pdbid|entity|chain(s)|sequence                                30   0.86 
3HEP:1:A|pdbid|entity|chain(s)|sequence                                30   0.87 
3HC9:1:A|pdbid|entity|chain(s)|sequence                                30   0.87 
1YMA:1:A|pdbid|entity|chain(s)|sequence                                30   0.87 
1MNO:1:A,B|pdbid|entity|chain(s)|sequence                              30   0.89 
1MDN:1:A,B|pdbid|entity|chain(s)|sequence                              30   0.89 
1M6M:1:A,B|pdbid|entity|chain(s)|sequence                              30   0.89 
1M6C:1:A,B|pdbid|entity|chain(s)|sequence                              30   0.89 
1HSY:1:A|pdbid|entity|chain(s)|sequence                                30   0.94 
1BJE:1:A|pdbid|entity|chain(s)|sequence                                30   0.94 
1MNH:1:A|pdbid|entity|chain(s)|sequence                                30   1.0  
1IT3:1:A,B,C,D|pdbid|entity|chain(s)|sequence                          30   1.0  
1IT2:1:A,B|pdbid|entity|chain(s)|sequence                              30   1.0  
1O16:1:A|pdbid|entity|chain(s)|sequence                                30   1.1  
1MBS:1:A|pdbid|entity|chain(s)|sequence                                30   1.1  
1MLS:1:A|pdbid|entity|chain(s)|sequence                                29   1.2  
1MLR:1:A|pdbid|entity|chain(s)|sequence                                29   1.2  
1MLQ:1:A|pdbid|entity|chain(s)|sequence                                29   1.2  
2SPO:1:A|pdbid|entity|chain(s)|sequence                                29   1.3  
2SPN:1:A|pdbid|entity|chain(s)|sequence                                29   1.5  
2SPM:1:A|pdbid|entity|chain(s)|sequence                                29   1.5  
2SPL:1:A|pdbid|entity|chain(s)|sequence                                29   1.5  
2G14:1:A|pdbid|entity|chain(s)|sequence                                29   1.5  
2G12:1:A|pdbid|entity|chain(s)|sequence                                29   1.5  
2G11:1:A|pdbid|entity|chain(s)|sequence                                29   1.5  
2G10:1:A|pdbid|entity|chain(s)|sequence                                29   1.5  
2G0Z:1:A|pdbid|entity|chain(s)|sequence                                29   1.5  
2G0X:1:A|pdbid|entity|chain(s)|sequence                                29   1.5  
2G0V:1:A|pdbid|entity|chain(s)|sequence                                29   1.5  
2G0S:1:A|pdbid|entity|chain(s)|sequence                                29   1.5  
2G0R:1:A|pdbid|entity|chain(s)|sequence                                29   1.5  
1MOA:1:A|pdbid|entity|chain(s)|sequence                                29   1.5  
1JDO:1:A|pdbid|entity|chain(s)|sequence                                29   1.5  
2EF2:1:A|pdbid|entity|chain(s)|sequence                                29   1.5  
1V9Q:1:A|pdbid|entity|chain(s)|sequence                                29   1.5  
1UFJ:1:A|pdbid|entity|chain(s)|sequence                                29   1.5  
1J3F:1:A|pdbid|entity|chain(s)|sequence                                29   1.5  
3SDN:1:A|pdbid|entity|chain(s)|sequence                                29   1.6  
1MLH:1:A|pdbid|entity|chain(s)|sequence                                29   1.8  
1MLG:1:A|pdbid|entity|chain(s)|sequence                                29   1.8  
1MLF:1:A|pdbid|entity|chain(s)|sequence                                29   1.8  
1MLL:1:A|pdbid|entity|chain(s)|sequence                                29   1.9  
1MLK:1:A|pdbid|entity|chain(s)|sequence                                29   1.9  
1MLJ:1:A|pdbid|entity|chain(s)|sequence                                29   1.9  
108M:1:A|pdbid|entity|chain(s)|sequence                                29   1.9  
107M:1:A|pdbid|entity|chain(s)|sequence                                29   1.9  
106M:1:A|pdbid|entity|chain(s)|sequence                                29   1.9  
1FCS:1:A|pdbid|entity|chain(s)|sequence                                29   1.9  
1MGN:1:A|pdbid|entity|chain(s)|sequence                                28   2.2  
1LTW:1:A|pdbid|entity|chain(s)|sequence                                28   2.4  
1DO7:1:A|pdbid|entity|chain(s)|sequence                                28   2.4  
1DO4:1:A|pdbid|entity|chain(s)|sequence                                28   2.4  
1DO3:1:A|pdbid|entity|chain(s)|sequence                                28   2.4  
1DO1:1:A|pdbid|entity|chain(s)|sequence                                28   2.4  
1MTI:1:A|pdbid|entity|chain(s)|sequence                                28   2.4  
2BWH:1:A|pdbid|entity|chain(s)|sequence                                28   2.4  
2BW9:1:M|pdbid|entity|chain(s)|sequence                                28   2.4  
2BLJ:1:M|pdbid|entity|chain(s)|sequence                                28   2.4  
2BLI:1:A|pdbid|entity|chain(s)|sequence                                28   2.4  
2BLH:1:A|pdbid|entity|chain(s)|sequence                                28   2.4  
3H58:1:A|pdbid|entity|chain(s)|sequence                                28   2.8  
3H57:1:A|pdbid|entity|chain(s)|sequence                                28   2.8  
2MGH:1:A|pdbid|entity|chain(s)|sequence                                28   2.8  
2MGG:1:A|pdbid|entity|chain(s)|sequence                                28   2.8  
2MGF:1:A|pdbid|entity|chain(s)|sequence                                28   2.8  
2MGE:1:A|pdbid|entity|chain(s)|sequence                                28   2.8  
2MGD:1:A|pdbid|entity|chain(s)|sequence                                28   2.8  
2MGC:1:A|pdbid|entity|chain(s)|sequence                                28   2.8  
3OGB:1:A|pdbid|entity|chain(s)|sequence                                28   2.9  
3NML:1:A|pdbid|entity|chain(s)|sequence                                28   2.9  
2MGJ:1:A|pdbid|entity|chain(s)|sequence                                28   2.9  
2MGI:1:A|pdbid|entity|chain(s)|sequence                                28   2.9  
1MOD:1:A|pdbid|entity|chain(s)|sequence                                28   2.9  
1MOC:1:A|pdbid|entity|chain(s)|sequence                                28   2.9  
1MNJ:1:A,B|pdbid|entity|chain(s)|sequence                              28   3.0  
2OH9:1:A|pdbid|entity|chain(s)|sequence                                28   3.1  
2MGB:1:A|pdbid|entity|chain(s)|sequence                                28   3.1  
2MGA:1:A|pdbid|entity|chain(s)|sequence                                28   3.1  
1MOB:1:A|pdbid|entity|chain(s)|sequence                                28   3.1  
103M:1:A|pdbid|entity|chain(s)|sequence                                28   3.2  
102M:1:A|pdbid|entity|chain(s)|sequence                                28   3.2  
4H0B:1:A|pdbid|entity|chain(s)|sequence                                28   3.3  
4H07:1:A|pdbid|entity|chain(s)|sequence                                28   3.3  
3O89:1:A|pdbid|entity|chain(s)|sequence                                28   3.3  
1MLU:1:A|pdbid|entity|chain(s)|sequence                                28   3.3  
1MYM:1:A|pdbid|entity|chain(s)|sequence                                28   3.4  
1MTK:1:A|pdbid|entity|chain(s)|sequence                                28   3.4  
1MTJ:1:A|pdbid|entity|chain(s)|sequence                                28   3.4  
101M:1:A|pdbid|entity|chain(s)|sequence                                28   3.4  
4IT8:1:A|pdbid|entity|chain(s)|sequence                                28   3.6  
1MNK:1:A,B|pdbid|entity|chain(s)|sequence                              28   3.9  
1MNI:1:A,B|pdbid|entity|chain(s)|sequence                              28   4.2  
1CG8:2:B|pdbid|entity|chain(s)|sequence                                27   4.6  
1CG5:2:B|pdbid|entity|chain(s)|sequence                                27   4.6  
1NAZ:1:A|pdbid|entity|chain(s)|sequence                                27   4.9  
1N9X:1:A|pdbid|entity|chain(s)|sequence                                27   4.9  
1N9I:1:A|pdbid|entity|chain(s)|sequence                                27   4.9  
1N9H:1:A|pdbid|entity|chain(s)|sequence                                27   4.9  
1N9F:1:A|pdbid|entity|chain(s)|sequence                                27   4.9  
1MZ0:1:A|pdbid|entity|chain(s)|sequence                                27   4.9  
1MYZ:1:A|pdbid|entity|chain(s)|sequence                                27   4.9  
1F65:1:A|pdbid|entity|chain(s)|sequence                                27   4.9  
1F63:1:A|pdbid|entity|chain(s)|sequence                                27   4.9  
1DXD:1:A|pdbid|entity|chain(s)|sequence                                27   4.9  
1DXC:1:A|pdbid|entity|chain(s)|sequence                                27   4.9  
2W6Y:1:A|pdbid|entity|chain(s)|sequence                                27   5.4  
2W6X:1:A|pdbid|entity|chain(s)|sequence                                27   5.4  
2E2Y:1:A|pdbid|entity|chain(s)|sequence                                27   6.0  
3U7B:1:A,B,C,D,E|pdbid|entity|chain(s)|sequence                        27   6.7  
1OBM:1:A|pdbid|entity|chain(s)|sequence                                27   7.1  
1MCY:1:A|pdbid|entity|chain(s)|sequence                                27   7.6  
4LPI:1:A|pdbid|entity|chain(s)|sequence                                27   8.2  
>1Z8U:2:B,D|pdbid|entity|chain(s)|sequence
          Length = 142

 Score =  143 bits (361), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 2  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 61

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 62 KVADALTNAVAHVDDMPNAL 81
>1Y01:2:B|pdbid|entity|chain(s)|sequence
          Length = 142

 Score =  143 bits (361), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 2  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 61

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 62 KVADALTNAVAHVDDMPNAL 81
>1VWT:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (361), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1RVW:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (361), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1BZ1:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 142

 Score =  143 bits (361), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 2  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 61

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 62 KVADALTNAVAHVDDMPNAL 81
>6HBW:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>4NI0:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>4N7P:1:A,C,E,G,I,K|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>4N7O:1:A,C,E,G,I,K|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>4N7N:1:A,C,E,G,I,K|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>4MQK:1:A,C,E,G|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>4MQJ:1:A,C,E,G|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>4MQG:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>4M4B:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>4M4A:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>4L7Y:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>4IJ2:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>4HHB:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>4FC3:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>3WCP:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>3SZK:1:A,D|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>3S66:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>3S65:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>3S48:2:C,D|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>3R5I:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>3QJE:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>3QJC:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>3P5Q:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>3OVU:3:C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>3OO5:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>3OO4:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>3ONZ:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>3ODQ:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>3NL7:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>3KMF:1:A,E|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>3IC2:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>3IC0:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>3HXN:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>3HHB:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>3DUT:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>3D7O:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>3D17:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>3B75:1:A,C,E,G,S|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>2YRS:1:A,C,I,M|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>2W6V:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>2M6Z:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>2HHE:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>2HHD:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>2HHB:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>2HCO:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>2HBS:1:A,C,E,G|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>2HBF:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>2HBE:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>2HBD:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>2HBC:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>2H35:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>2DXM:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>2DN3:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>2DN2:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>2DN1:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>2D60:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>2D5Z:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1YZI:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1YVT:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1YVQ:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1YIH:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1YIE:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1YHR:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1YHE:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1YH9:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1YGF:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1YGD:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1YG5:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1YFF:1:A,C,E,G|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1YEV:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1YEU:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1YEQ:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1YEO:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1YEN:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1YE2:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1YE1:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1YE0:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1Y85:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1Y83:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1Y7Z:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1Y7G:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1Y7D:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1Y7C:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1Y5K:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1Y5J:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1Y5F:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1Y4V:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1Y4R:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1Y4Q:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1Y4P:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1Y4G:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1Y4F:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1Y4B:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1Y46:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1Y45:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1Y35:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1Y31:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1Y2Z:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1Y22:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1Y0W:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1Y0T:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1XZ2:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1XXT:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1UIW:1:A,C,E,G|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1THB:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1SI4:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1SHR:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1SDL:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1SDK:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1RQA:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1RQ4:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1RQ3:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1RPS:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1QXE:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1QXD:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1QSI:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1QSH:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1O1P:1:A|pdbid|entity|chain(s)|sequence
          Length = 283

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 143 VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 202

Query: 61  KVADALT-AVAHVDDMPNAL 79
           KVADALT AVAHVDDMPNAL
Sbjct: 203 KVADALTNAVAHVDDMPNAL 222

 Score =  142 bits (357), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 78/80 (97%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          +LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1NQP:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1NIH:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1NEJ:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1MKO:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1M9P:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1LJW:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1LFZ:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1LFY:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1LFV:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1LFT:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1LFQ:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1LFL:1:A,C,P,R|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1KD2:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1K1K:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1K0Y:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1JY7:1:A,C,P,R,U,W|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1J41:1:A,C,E,G|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1J40:1:A,C,E,G|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1J3Z:1:A,C,E,G|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1J3Y:1:A,C,E,G|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1IRD:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1HHO:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1HGC:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1HGB:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1HGA:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1HDB:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1HCO:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1HBS:1:A,C,E,G|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1HBB:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1HBA:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1HAC:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1HAB:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1GZX:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1GBV:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1GBU:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1G9V:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1FN3:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1FDH:1:A,B|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1DXV:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1DXU:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1DXT:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1DKE:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1COH:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1CMY:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1CLS:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1C7C:1:A|pdbid|entity|chain(s)|sequence
          Length = 283

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 143 VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 202

Query: 61  KVADALT-AVAHVDDMPNAL 79
           KVADALT AVAHVDDMPNAL
Sbjct: 203 KVADALTNAVAHVDDMPNAL 222

 Score =  142 bits (357), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 78/80 (97%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          +LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1BZ0:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1BUW:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1BIJ:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1BBB:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1B86:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1ABY:1:A|pdbid|entity|chain(s)|sequence
          Length = 283

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 143 VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 202

Query: 61  KVADALT-AVAHVDDMPNAL 79
           KVADALT AVAHVDDMPNAL
Sbjct: 203 KVADALTNAVAHVDDMPNAL 222

 Score =  142 bits (357), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 78/80 (97%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          +LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1ABW:1:A|pdbid|entity|chain(s)|sequence
          Length = 283

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 143 VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 202

Query: 61  KVADALT-AVAHVDDMPNAL 79
           KVADALT AVAHVDDMPNAL
Sbjct: 203 KVADALTNAVAHVDDMPNAL 222

 Score =  142 bits (357), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 78/80 (97%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          +LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1A9W:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1A3N:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1A0Z:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1A0U:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1A01:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1A00:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  143 bits (360), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1C7D:1:A|pdbid|entity|chain(s)|sequence
          Length = 284

 Score =  143 bits (360), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 144 VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 203

Query: 61  KVADALT-AVAHVDDMPNAL 79
           KVADALT AVAHVDDMPNAL
Sbjct: 204 KVADALTNAVAHVDDMPNAL 223

 Score =  142 bits (357), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 78/80 (97%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          +LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1AJ9:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  142 bits (359), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 78/80 (97%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGS+QVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSSQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>4MQI:1:A|pdbid|entity|chain(s)|sequence
          Length = 140

 Score =  142 bits (359), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>3IA3:2:B,D|pdbid|entity|chain(s)|sequence
          Length = 145

 Score =  142 bits (359), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 5  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 64

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 65 KVADALTNAVAHVDDMPNAL 84
>1Y0D:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 140

 Score =  142 bits (359), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1R1Y:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  142 bits (358), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1R1X:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  142 bits (358), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 79/80 (98%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1BAB:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 143

 Score =  142 bits (357), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 78/79 (98%), Positives = 78/79 (98%), Gaps = 1/79 (1%)

Query: 2  LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKK 61
          LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKK
Sbjct: 4  LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKK 63

Query: 62 VADALT-AVAHVDDMPNAL 79
          VADALT AVAHVDDMPNAL
Sbjct: 64 VADALTNAVAHVDDMPNAL 82
>1YDZ:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  142 bits (357), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 78/80 (97%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          +LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1Y0C:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  142 bits (357), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 78/80 (97%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          +LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>4MQC:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  142 bits (357), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 78/80 (97%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          K+ADALT AVAHVDDMPNAL
Sbjct: 61 KMADALTNAVAHVDDMPNAL 80
>1O1K:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  142 bits (357), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 78/80 (97%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          +LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1J7W:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  142 bits (357), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 78/80 (97%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          +LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1C7B:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  142 bits (357), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 78/80 (97%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          +LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1BZZ:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  142 bits (357), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 78/80 (97%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          +LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1XZU:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  142 bits (357), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 78/80 (97%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          +LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1XZV:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  141 bits (356), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 78/80 (97%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          +LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1O1O:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  141 bits (355), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 77/80 (96%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          +LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          K+ADALT AVAHVDDMPNAL
Sbjct: 61 KLADALTNAVAHVDDMPNAL 80
>4MQH:1:A|pdbid|entity|chain(s)|sequence
          Length = 139

 Score =  141 bits (355), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 78/80 (97%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          K+ADALT AVAHVDDMPNAL
Sbjct: 61 KMADALTNAVAHVDDMPNAL 80
>1Y0A:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  141 bits (355), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 78/80 (97%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          +LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1Y09:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  141 bits (355), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 78/80 (97%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          +LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1O1N:1:A|pdbid|entity|chain(s)|sequence
          Length = 285

 Score =  141 bits (355), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 78/80 (97%), Positives = 78/80 (97%), Gaps = 1/80 (1%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEA ERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 145 VLSPADKTNVKAAWGKVGAHAGEYGAEAWERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 204

Query: 61  KVADALT-AVAHVDDMPNAL 79
           KVADALT AVAHVDDMPNAL
Sbjct: 205 KVADALTNAVAHVDDMPNAL 224

 Score =  140 bits (352), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 77/80 (96%), Positives = 78/80 (97%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          +LSPADKTNVKAAWGKVGAHAGEYGAEA ERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  MLSPADKTNVKAAWGKVGAHAGEYGAEAWERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1XZ5:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  141 bits (355), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 78/80 (97%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          +LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1Y8W:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  140 bits (354), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 78/80 (97%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          +LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1XZ7:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  140 bits (354), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 78/80 (97%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          +LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>3NMM:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  140 bits (354), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 78/80 (97%), Positives = 78/80 (97%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKG GK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGWGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>3QJD:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  140 bits (354), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 78/80 (97%), Positives = 78/80 (97%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKG GK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGLGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>3QJB:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  140 bits (354), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 78/80 (97%), Positives = 78/80 (97%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKG GK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGLGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1A3O:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  140 bits (353), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 78/80 (97%), Positives = 79/80 (98%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKT+FPHFDLSHGSAQVKGHGK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTHFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1O1J:1:A|pdbid|entity|chain(s)|sequence
          Length = 283

 Score =  140 bits (352), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 77/80 (96%), Positives = 77/80 (96%), Gaps = 1/80 (1%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEA ERMFLSFPTTKTYFPHFDLSHGSAQVKG GK
Sbjct: 143 VLSPADKTNVKAAWGKVGAHAGEYGAEAFERMFLSFPTTKTYFPHFDLSHGSAQVKGQGK 202

Query: 61  KVADALT-AVAHVDDMPNAL 79
           KVADALT AVAHVDDMPNAL
Sbjct: 203 KVADALTNAVAHVDDMPNAL 222

 Score =  139 bits (349), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 76/80 (95%), Positives = 77/80 (96%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          +LSPADKTNVKAAWGKVGAHAGEYGAEA ERMFLSFPTTKTYFPHFDLSHGSAQVKG GK
Sbjct: 1  MLSPADKTNVKAAWGKVGAHAGEYGAEAFERMFLSFPTTKTYFPHFDLSHGSAQVKGQGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1GLI:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  140 bits (352), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 77/80 (96%), Positives = 78/80 (97%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          +LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFP TKTYFPHFDLSHGSAQVKGHGK
Sbjct: 1  MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPWTKTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1XY0:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  140 bits (352), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 77/80 (96%), Positives = 78/80 (97%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          +LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTT TYFPHFDLSHGSAQVKGHGK
Sbjct: 1  MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTGTYFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1O1M:1:A|pdbid|entity|chain(s)|sequence
          Length = 285

 Score =  139 bits (351), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 77/80 (96%), Positives = 77/80 (96%), Gaps = 1/80 (1%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEA ERMFLSFPTTKTYFPHFDLSHGSAQVKG GK
Sbjct: 145 VLSPADKTNVKAAWGKVGAHAGEYGAEAFERMFLSFPTTKTYFPHFDLSHGSAQVKGQGK 204

Query: 61  KVADALT-AVAHVDDMPNAL 79
           KVADALT AVAHVDDMPNAL
Sbjct: 205 KVADALTNAVAHVDDMPNAL 224

 Score =  139 bits (349), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 76/80 (95%), Positives = 77/80 (96%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          +LSPADKTNVKAAWGKVGAHAGEYGAEA ERMFLSFPTTKTYFPHFDLSHGSAQVKG GK
Sbjct: 1  MLSPADKTNVKAAWGKVGAHAGEYGAEAFERMFLSFPTTKTYFPHFDLSHGSAQVKGQGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1O1L:1:A|pdbid|entity|chain(s)|sequence
          Length = 283

 Score =  139 bits (351), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 77/80 (96%), Positives = 77/80 (96%), Gaps = 1/80 (1%)

Query: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
           VLSPADKTNVKAAWGKVGAHAGEYGAEA ERMFLSFPTTKTYFPHFDLSHGSAQVKG GK
Sbjct: 143 VLSPADKTNVKAAWGKVGAHAGEYGAEAWERMFLSFPTTKTYFPHFDLSHGSAQVKGQGK 202

Query: 61  KVADALT-AVAHVDDMPNAL 79
           KVADALT AVAHVDDMPNAL
Sbjct: 203 KVADALTNAVAHVDDMPNAL 222

 Score =  138 bits (348), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 76/80 (95%), Positives = 77/80 (96%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          +LSPADKTNVKAAWGKVGAHAGEYGAEA ERMFLSFPTTKTYFPHFDLSHGSAQVKG GK
Sbjct: 1  MLSPADKTNVKAAWGKVGAHAGEYGAEAWERMFLSFPTTKTYFPHFDLSHGSAQVKGQGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>2W72:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  139 bits (351), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 77/80 (96%), Positives = 77/80 (96%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLSPADKTNVKAAWGKVGAHAGEYGAEA ERMFLSFPTTKTYFPHFDLSHGSAQVKG GK
Sbjct: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEAYERMFLSFPTTKTYFPHFDLSHGSAQVKGQGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1O1I:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  139 bits (349), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 76/80 (95%), Positives = 77/80 (96%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          +LSPADKTNVKAAWGKVGAHAGEYGAEA ERMFLSFPTTKTYFPHFDLSHGSAQVKG GK
Sbjct: 1  MLSPADKTNVKAAWGKVGAHAGEYGAEAFERMFLSFPTTKTYFPHFDLSHGSAQVKGQGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>2W72:3:C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  138 bits (348), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 76/80 (95%), Positives = 77/80 (96%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          +LSPADKTNVKAAWGKVGAHAGEYGAEA ERMFLSFPTTKTYFPHFDLSHGSAQVKG GK
Sbjct: 1  MLSPADKTNVKAAWGKVGAHAGEYGAEAYERMFLSFPTTKTYFPHFDLSHGSAQVKGQGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1QI8:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  138 bits (348), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 76/80 (95%), Positives = 77/80 (96%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          +LSPADKTNVKAAWGKVGAHAGEYGAEA ERMFLSFPTTKTYFPHFDLSHGSAQVKG GK
Sbjct: 1  MLSPADKTNVKAAWGKVGAHAGEYGAEAYERMFLSFPTTKTYFPHFDLSHGSAQVKGQGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1J7Y:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  138 bits (348), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 76/80 (95%), Positives = 77/80 (96%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          +LSPADKTNVKAAWGKVGAHAGEYGAEA ERMFLSFPTTKTYFPHFDLSHGSAQVKG GK
Sbjct: 1  MLSPADKTNVKAAWGKVGAHAGEYGAEAYERMFLSFPTTKTYFPHFDLSHGSAQVKGQGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1J7S:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  138 bits (348), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 76/80 (95%), Positives = 77/80 (96%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          +LSPADKTNVKAAWGKVGAHAGEYGAEA ERMFLSFPTTKTYFPHFDLSHGSAQVKG GK
Sbjct: 1  MLSPADKTNVKAAWGKVGAHAGEYGAEAYERMFLSFPTTKTYFPHFDLSHGSAQVKGQGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1XZ4:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  138 bits (347), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 77/80 (96%), Positives = 78/80 (97%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          +LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKT FPHFDLSHGSAQVKGHGK
Sbjct: 1  MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTAFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>1XYE:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  138 bits (347), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 77/80 (96%), Positives = 78/80 (97%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          +LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKT FPHFDLSHGSAQVKGHGK
Sbjct: 1  MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTAFPHFDLSHGSAQVKGHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAHVDDMPNAL
Sbjct: 61 KVADALTNAVAHVDDMPNAL 80
>2ZLX:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  129 bits (324), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 69/80 (86%), Positives = 71/80 (88%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLS ADKTNVKAAW KVG HAGEYGAEALERMFL FPTTKTYFPHFDLSHGSAQVK HGK
Sbjct: 1  VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KV DALT AV H+DD+P AL
Sbjct: 61 KVGDALTLAVGHLDDLPGAL 80
>2ZLW:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  129 bits (324), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 69/80 (86%), Positives = 71/80 (88%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLS ADKTNVKAAW KVG HAGEYGAEALERMFL FPTTKTYFPHFDLSHGSAQVK HGK
Sbjct: 1  VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KV DALT AV H+DD+P AL
Sbjct: 61 KVGDALTLAVGHLDDLPGAL 80
>2ZLV:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  129 bits (324), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 69/80 (86%), Positives = 71/80 (88%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLS ADKTNVKAAW KVG HAGEYGAEALERMFL FPTTKTYFPHFDLSHGSAQVK HGK
Sbjct: 1  VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KV DALT AV H+DD+P AL
Sbjct: 61 KVGDALTLAVGHLDDLPGAL 80
>2ZLU:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  129 bits (324), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 69/80 (86%), Positives = 71/80 (88%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLS ADKTNVKAAW KVG HAGEYGAEALERMFL FPTTKTYFPHFDLSHGSAQVK HGK
Sbjct: 1  VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KV DALT AV H+DD+P AL
Sbjct: 61 KVGDALTLAVGHLDDLPGAL 80
>2ZLT:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  129 bits (324), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 69/80 (86%), Positives = 71/80 (88%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLS ADKTNVKAAW KVG HAGEYGAEALERMFL FPTTKTYFPHFDLSHGSAQVK HGK
Sbjct: 1  VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KV DALT AV H+DD+P AL
Sbjct: 61 KVGDALTLAVGHLDDLPGAL 80
>2MHB:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  129 bits (324), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 69/80 (86%), Positives = 71/80 (88%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLS ADKTNVKAAW KVG HAGEYGAEALERMFL FPTTKTYFPHFDLSHGSAQVK HGK
Sbjct: 1  VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KV DALT AV H+DD+P AL
Sbjct: 61 KVGDALTLAVGHLDDLPGAL 80
>2DHB:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  129 bits (324), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 69/80 (86%), Positives = 71/80 (88%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLS ADKTNVKAAW KVG HAGEYGAEALERMFL FPTTKTYFPHFDLSHGSAQVK HGK
Sbjct: 1  VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVAD LT AV H+DD+P AL
Sbjct: 61 KVADGLTLAVGHLDDLPGAL 80
>2D5X:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  129 bits (324), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 69/80 (86%), Positives = 71/80 (88%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLS ADKTNVKAAW KVG HAGEYGAEALERMFL FPTTKTYFPHFDLSHGSAQVK HGK
Sbjct: 1  VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KV DALT AV H+DD+P AL
Sbjct: 61 KVGDALTLAVGHLDDLPGAL 80
>1Y8K:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  129 bits (324), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 69/80 (86%), Positives = 71/80 (88%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLS ADKTNVKAAW KVG HAGEYGAEALERMFL FPTTKTYFPHFDLSHGSAQVK HGK
Sbjct: 1  VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KV DALT AV H+DD+P AL
Sbjct: 61 KVGDALTLAVGHLDDLPGAL 80
>1Y8I:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  129 bits (324), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 69/80 (86%), Positives = 71/80 (88%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLS ADKTNVKAAW KVG HAGEYGAEALERMFL FPTTKTYFPHFDLSHGSAQVK HGK
Sbjct: 1  VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KV DALT AV H+DD+P AL
Sbjct: 61 KVGDALTLAVGHLDDLPGAL 80
>1Y8H:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  129 bits (324), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 69/80 (86%), Positives = 71/80 (88%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLS ADKTNVKAAW KVG HAGEYGAEALERMFL FPTTKTYFPHFDLSHGSAQVK HGK
Sbjct: 1  VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KV DALT AV H+DD+P AL
Sbjct: 61 KVGDALTLAVGHLDDLPGAL 80
>1NS9:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  129 bits (324), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 69/80 (86%), Positives = 71/80 (88%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLS ADKTNVKAAW KVG HAGEYGAEALERMFL FPTTKTYFPHFDLSHGSAQVK HGK
Sbjct: 1  VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KV DALT AV H+DD+P AL
Sbjct: 61 KVGDALTLAVGHLDDLPGAL 80
>1NS6:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  129 bits (324), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 69/80 (86%), Positives = 71/80 (88%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLS ADKTNVKAAW KVG HAGEYGAEALERMFL FPTTKTYFPHFDLSHGSAQVK HGK
Sbjct: 1  VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KV DALT AV H+DD+P AL
Sbjct: 61 KVGDALTLAVGHLDDLPGAL 80
>1IWH:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  129 bits (324), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 69/80 (86%), Positives = 71/80 (88%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLS ADKTNVKAAW KVG HAGEYGAEALERMFL FPTTKTYFPHFDLSHGSAQVK HGK
Sbjct: 1  VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KV DALT AV H+DD+P AL
Sbjct: 61 KVGDALTLAVGHLDDLPGAL 80
>1G0B:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  129 bits (324), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 69/80 (86%), Positives = 71/80 (88%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLS ADKTNVKAAW KVG HAGEYGAEALERMFL FPTTKTYFPHFDLSHGSAQVK HGK
Sbjct: 1  VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KV DALT AV H+DD+P AL
Sbjct: 61 KVGDALTLAVGHLDDLPGAL 80
>1IBE:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  127 bits (320), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 68/80 (85%), Positives = 71/80 (88%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLS ADKTNVKAAW KVG HAGE+GAEALERMFL FPTTKTYFPHFDLSHGSAQVK HGK
Sbjct: 1  VLSAADKTNVKAAWSKVGGHAGEFGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KV DALT AV H+DD+P AL
Sbjct: 61 KVGDALTLAVGHLDDLPGAL 80
>3GYS:1:A,C,E,G|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  127 bits (318), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 66/80 (82%), Positives = 73/80 (91%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLS ADK+NVKA WGK+G+HAGEYGAEALER F SFPTTKTYFPHFDLSHGSAQVK HG+
Sbjct: 1  VLSAADKSNVKACWGKIGSHAGEYGAEALERTFCSFPTTKTYFPHFDLSHGSAQVKAHGQ 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAH+DD+P A+
Sbjct: 61 KVADALTQAVAHMDDLPTAM 80
>3GQR:1:A,C,E,G|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  127 bits (318), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 66/80 (82%), Positives = 73/80 (91%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLS ADK+NVKA WGK+G+HAGEYGAEALER F SFPTTKTYFPHFDLSHGSAQVK HG+
Sbjct: 1  VLSAADKSNVKACWGKIGSHAGEYGAEALERTFCSFPTTKTYFPHFDLSHGSAQVKAHGQ 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAH+DD+P A+
Sbjct: 61 KVADALTQAVAHMDDLPTAM 80
>3GQP:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  127 bits (318), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 66/80 (82%), Positives = 73/80 (91%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLS ADK+NVKA WGK+G+HAGEYGAEALER F SFPTTKTYFPHFDLSHGSAQVK HG+
Sbjct: 1  VLSAADKSNVKACWGKIGSHAGEYGAEALERTFCSFPTTKTYFPHFDLSHGSAQVKAHGQ 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAH+DD+P A+
Sbjct: 61 KVADALTQAVAHMDDLPTAM 80
>3D4X:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  127 bits (318), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 66/80 (82%), Positives = 73/80 (91%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLS ADK+NVKA WGK+G+HAGEYGAEALER F SFPTTKTYFPHFDLSHGSAQVK HG+
Sbjct: 1  VLSAADKSNVKACWGKIGSHAGEYGAEALERTFCSFPTTKTYFPHFDLSHGSAQVKAHGQ 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVADALT AVAH+DD+P A+
Sbjct: 61 KVADALTQAVAHMDDLPTAM 80
>1S0H:1:A|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  126 bits (316), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 67/80 (83%), Positives = 71/80 (88%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLS ADKTNVKAAW KVG +AGE+GAEALERMFL FPTTKTYFPHFDLSHGSAQVK HGK
Sbjct: 1  VLSAADKTNVKAAWSKVGGNAGEFGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KV DALT AV H+DD+P AL
Sbjct: 61 KVGDALTLAVGHLDDLPGAL 80
>3D1A:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 142

 Score =  124 bits (312), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 67/80 (83%), Positives = 72/80 (90%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLS ADK+NVKAAWGKVG +AG YGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG+
Sbjct: 2  VLSAADKSNVKAAWGKVGGNAGAYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGE 61

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVA ALT AV H+DD+P  L
Sbjct: 62 KVAAALTKAVGHLDDLPGTL 81
>3EU1:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  124 bits (311), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 67/80 (83%), Positives = 72/80 (90%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLS ADK+NVKAAWGKVG +AG YGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG+
Sbjct: 1  VLSAADKSNVKAAWGKVGGNAGAYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGE 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVA ALT AV H+DD+P  L
Sbjct: 61 KVAAALTKAVGHLDDLPGTL 80
>2RI4:1:A,C,I,K|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  124 bits (311), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 67/80 (83%), Positives = 72/80 (90%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLS ADK+NVKAAWGKVG +AG YGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG+
Sbjct: 1  VLSAADKSNVKAAWGKVGGNAGAYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGE 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVA ALT AV H+DD+P  L
Sbjct: 61 KVAAALTKAVGHLDDLPGTL 80
>2QU0:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  124 bits (311), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 67/80 (83%), Positives = 72/80 (90%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLS ADK+NVKAAWGKVG +AG YGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG+
Sbjct: 1  VLSAADKSNVKAAWGKVGGNAGAYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGE 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVA ALT AV H+DD+P  L
Sbjct: 61 KVAAALTKAVGHLDDLPGTL 80
>3CY5:1:A,C|pdbid|entity|chain(s)|sequence
          Length = 141

 Score =  124 bits (311), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 66/80 (82%), Positives = 73/80 (91%), Gaps = 1/80 (1%)

Query: 1  VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60
          VLS ADK+N++AAWGKVG HA +YGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG 
Sbjct: 1  VLSAADKSNIQAAWGKVGGHAADYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGA 60

Query: 61 KVADALT-AVAHVDDMPNAL 79
          KVA+ALT AV H+DD+P AL
Sbjct: 61 KVANALTKAVGHLDDLPGAL 80
  Database: pdb_polypeptide
    Posted date:  Aug 23, 2014 12:12 AM
  Number of letters in database: 34,951,095
  Number of sequences in database:  146,201
  
Lambda     K      H
   0.316    0.130    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 146201
Number of Hits to DB: 5,849,666
Number of extensions: 202207
Number of successful extensions: 1990
Number of sequences better than 10.0: 999
Number of HSP's gapped: 1434
Number of HSP's successfully gapped: 1008
Length of query: 79
Length of database: 34,951,095
Length adjustment: 48
Effective length of query: 31
Effective length of database: 27,933,447
Effective search space: 865936857
Effective search space used: 865936857
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 57 (26.6 bits)